IKMC Project Report - KOMP-CSD (ID: 24081)

Oc90 MGI:1313269 ENSMUSG00000015001 OTTMUSG00000024544
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000060522 protein_coding No protein product (NMD) view

Predicted translation:

MIMLLMVGMLMAPCVGAHALDTPNPQELPPGLSKNINITFFNGVFKNVESVAEIFAAASSIAGAMRKLLRWTVSKTLPSS
VQMWIAPTNRSHVSPRIPVSVYCVRVTRLLWSAWLSLASTPP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000787771 UTR UTR
ENSMUSE00000501770 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000125977 CDS CDS
ENSMUSE00000459411 CDS CDS
ENSMUSE00000459407 PLipase_A2_euk (39/106 aa) CDS Deleted
ENSMUSE00000125974 PLipase_A2_euk (39/106 aa) CDS CDS
ENSMUSE00000125980 PLipase_A2_euk (30/106 aa) CDS CDS + stop codon + UTR
ENSMUSE00000125970 CDS
ENSMUSE00000221703 CDS
ENSMUSE00000221698 CDS
ENSMUSE00000125969 CDS
ENSMUSE00000125971 CDS
ENSMUSE00000389985 PLipase_A2_euk (39/107 aa) CDS
ENSMUSE00000125979 PLipase_A2_euk (37/107 aa) CDS
ENSMUSE00000810198 PLipase_A2_euk (33/107 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000079776 protein_coding No protein product (NMD) view

Predicted translation:

MIMLLMVGMLMAPCVGAHALDTPNPQELPPGLSKNINITFFNGVFKNVESVAEIFAAASSIAGAMRKLLRWTVSKTLPSS
VQMWIAPTNRSHVSPRIPVSVYCVRVTRLLWSAWLSLASTPP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001068379 UTR UTR
ENSMUSE00000501770 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000125977 CDS CDS
ENSMUSE00000459411 CDS CDS
ENSMUSE00000459407 PLipase_A2_euk (39/106 aa) CDS Deleted
ENSMUSE00000125974 PLipase_A2_euk (39/106 aa) CDS CDS
ENSMUSE00000125980 PLipase_A2_euk (30/106 aa) CDS CDS + stop codon + UTR
ENSMUSE00000125970 CDS
ENSMUSE00000125969 CDS
ENSMUSE00000125971 CDS
ENSMUSE00000560273 PLipase_A2_euk (39/108 aa) CDS
ENSMUSE00000125979 PLipase_A2_euk (37/108 aa) CDS
ENSMUSE00000810198 PLipase_A2_euk (34/108 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000135442 protein_coding Target region does not overlap transcript
ENSMUST00000156996 protein_coding No analysis available: incomplete transcript
ENSMUST00000147776 protein_coding Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 42914 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00049_Y_1_B11 L1L2_Bact_P R3R4_pBR_amp view
order 42914 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00049_Y_2_B11 L1L2_Bact_P R3R4_pBR_amp view
order 42914 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00049_Y_4_B11 L1L2_Bact_P R3R4_pBR_amp view
order 42914 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00049_A_B11 L1L2_Bact_P R3R4_pBR_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
42914 Knockout First, Reporter-tagged insertion with conditional potential PCS00049_A_B11