IKMC Project Report - KOMP-CSD (ID: 24495)

Panx3 MGI:1918881 ENSMUSG00000011118 OTTMUSG00000027406
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000011262 protein_coding No protein product (NMD) view

Predicted translation: 

MSLAHTAAEYMLSDALLPDRRGSRLKGLRLELPLDKMVKFITVGFPLLLMSLAFAQEFSSGSSLLSTGSGCGHVSASVAV
AICSCALPQL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000357257 Innexin (26/212 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001059856 Innexin (48/212 aa) CDS Deleted
ENSMUSE00000216994 Innexin (72/212 aa) CDS CDS + stop codon + UTR
ENSMUSE00000408352 Innexin (68/212 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000142228 nonsense_mediated_decay No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 45579 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00057_Z_4_A09 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45579 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00057_Z_3_A09 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45579 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00057_A_A09 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 45579 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00057_Z_1_A09 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
45579 Knockout-First - Reporter Tagged Insertion PCS00057_A_A09