IKMC Project Report - KOMP-CSD (ID: 24499)

0610010K14Rik MGI:1915609 ENSMUSG00000020831 OTTMUSG00000006039
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 14 wild type transcripts, of which 10 are protein-coding. Following removal of the floxed region, 10 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000108576 protein_coding No protein product (NMD) view

Predicted translation: 

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGCDTQCSERLRRQQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000954236 CDS CDS
ENSMUSE00001062144 CDS CDS
ENSMUSE00001042950 CDS Deleted
ENSMUSE00000983457 CDS Deleted
ENSMUSE00001002158 CDS CDS + stop codon + UTR
ENSMUSE00000950288 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000108578 protein_coding No protein product (NMD) view

Predicted translation: 

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGCDTQCSERLRRQQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000661967 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001062144 CDS CDS
ENSMUSE00001042950 CDS Deleted
ENSMUSE00000983457 CDS Deleted
ENSMUSE00001002158 CDS CDS + stop codon + UTR
ENSMUSE00001049748 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000021181 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGQPDPGLWPPHHLR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000661967 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001062144 CDS CDS
ENSMUSE00001042950 CDS Deleted
ENSMUSE00000983457 CDS Deleted
ENSMUSE00001001373 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000102569 protein_coding No protein product (NMD) view

Predicted translation: 

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGCDTQCSERLRRQQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000661967 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001062144 CDS CDS
ENSMUSE00000983457 CDS Deleted
ENSMUSE00001002158 CDS CDS + stop codon + UTR
ENSMUSE00001049748 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000108579 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGQPDPGLWPPHHLR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000677265 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001062144 CDS CDS
ENSMUSE00000983457 CDS Deleted
ENSMUSE00001001373 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000108575 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGQPDPGLWPPHHLR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000458761 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001062144 CDS CDS
ENSMUSE00000651455 CDS + stop codon + UTR Deleted
ENSMUSE00001018667 UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000100950 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MLLRPQVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGQPDPGLWPPHHLR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000677260 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001042950 CDS Deleted
ENSMUSE00000983457 CDS Deleted
ENSMUSE00000677259 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000108577 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGLTLDSGLLTTSADAPLLSC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000677261 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001062144 CDS CDS
ENSMUSE00000983457 CDS Deleted
ENSMUSE00000677263 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000135390 protein_coding No analysis available: incomplete transcript
ENSMUST00000134700 protein_coding No analysis available: incomplete transcript
ENSMUST00000021180 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000150504 retained_intron No analysis available: incomplete transcript
ENSMUST00000148878 processed_transcript No analysis available: incomplete transcript
ENSMUST00000138658 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 213064 Deletion (Promotor Driven Cassette) PG00158_Y_2_H03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 213064 Deletion (Promotor Driven Cassette) DPGS00158_A_H03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 213064 Deletion (Promotor Driven Cassette) PG00158_Y_6_H03 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 213064 Deletion (Promotor Driven Cassette) PG00158_Y_1_H03 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
213064 Deletion PCS00158_A_H03