IKMC Project Report - KOMP-CSD (ID: 24816)

I830077J02Rik MGI:3588284 ENSMUSG00000074342 OTTMUSG00000026612
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000098758 protein_coding Novel C-terminal product view

Predicted translation: 

MSLQCPDPGPSLRASHQTVVFIKGVTHVCQHDFQAPRRKQQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000636879 UTR UTR
ENSMUSE00001067840 UTR + start codon + CDS
ENSMUSE00000636875 CDS Deleted
ENSMUSE00000636874 CDS UTR + start codon + CDS
ENSMUSE00000636873 CDS CDS
ENSMUSE00000636872 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000126230 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 44979 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00052_A_7_D08 L1L2_gt1 L3L4_pZero_DTA_kan view
order 44979 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00052_A_8_D08 L1L2_gt1 L3L4_pZero_DTA_kan view
order 44979 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00052_A_D08 L1L2_gt1 L3L4_pZero_DTA_kan view
order 44979 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00052_A_5_D08 L1L2_gt1 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
44979 Knockout First, Reporter-tagged insertion with conditional potential PCS00052_A_D08