IKMC Project Report - EUCOMM (ID: 25556)

Atraid MGI:1918918 ENSMUSG00000013622 OTTMUSG00000022387
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000013766 protein_coding No protein product (NMD) view

Predicted translation:

MASRESGGSRAAALLLVLGVERALALPEICTLCPGGMHNLSRVAAYCEDTSKLMQARCCLNQKGTILGNVS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000700132 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001084795 CDS CDS
ENSMUSE00000969417 CDS Deleted
ENSMUSE00001054131 CDS Deleted
ENSMUSE00001065829 CDS Deleted
ENSMUSE00001007766 CDS CDS + stop codon + UTR
ENSMUSE00000753626 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000114659 protein_coding Residual C-terminal product view

Predicted translation:

MCPENGSCASDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKAS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000700118 UTR UTR
ENSMUSE00001004771 UTR + start codon + CDS
ENSMUSE00000969417 CDS Deleted
ENSMUSE00001054131 CDS Deleted
ENSMUSE00001065829 CDS Deleted
ENSMUSE00001007766 CDS UTR + start codon + CDS
ENSMUSE00000700116 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000173215 protein_coding No analysis available: incomplete transcript
ENSMUST00000130250 protein_coding No analysis available: incomplete transcript
ENSMUST00000153643 protein_coding No analysis available: incomplete transcript
ENSMUST00000114660 nonsense_mediated_decay Residual N-terminal, novel C-terminal product view

Predicted translation:

MASRESGGSRAAALLLVLGVERALALPEICTLCPGEMCPENGSCASDGPGLLQCVCADGFHGYKCMRQGSFSLLMFFGIL
GSTTLAISILLWGTQRRKAKAS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000654980 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000700120 CDS CDS
ENSMUSE00001045922 CDS + stop codon + UTR Deleted
ENSMUSE00000990960 UTR Deleted
ENSMUSE00001066443 UTR Deleted
ENSMUSE00000975108 UTR CDS
ENSMUSE00000700119 UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000138309 retained_intron No analysis available: incomplete transcript
ENSMUST00000133215 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 47896 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00119_Z_3_H10 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47896 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00119_Z_2_H10 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47896 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00119_Z_1_H10 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47896 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00119_Z_4_H10 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47896 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00119_A_H10 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
47896 Knockout-First - Reporter Tagged Insertion PCS00119_A_H10
47896 Knockout-First - Reporter Tagged Insertion PCS00119_B_H10