IKMC Project Report - KOMP-CSD (ID: 25620)

Ikbkap MGI:1914544 ENSMUSG00000028431 OTTMUSG00000007272
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000030140 protein_coding No protein product (NMD) view

Predicted translation:

MRNLKLHRTLEFRDIQAPGKPQCFCLRAEQGTVLIGSERGLTEVDPVRREVKTEISLVAEGFLPEDGSGCIVGIQDLLDQ
ESVCVATASGDVIVCNLSTQQLNRP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000349138 UTR UTR
ENSMUSE00000328270 IKI3 (49/955 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000328262 IKI3 (51/955 aa) CDS CDS
ENSMUSE00000328253 IKI3 (28/955 aa) CDS Deleted
ENSMUSE00000179097 IKI3 (28/955 aa) CDS CDS + stop codon + UTR
ENSMUSE00000179091 IKI3 (29/955 aa) CDS
ENSMUSE00000179083 IKI3 (33/955 aa) CDS
ENSMUSE00000179099 IKI3 (31/955 aa) CDS
ENSMUSE00000179078 IKI3 (42/955 aa) CDS
ENSMUSE00000179069 IKI3 (32/955 aa) CDS
ENSMUSE00000179059 IKI3 (78/955 aa) CDS
ENSMUSE00000328203 IKI3 (56/955 aa) CDS
ENSMUSE00000179073 IKI3 (34/955 aa) CDS
ENSMUSE00000328193 IKI3 (65/955 aa) CDS
ENSMUSE00000179077 IKI3 (37/955 aa) CDS
ENSMUSE00001076473 IKI3 (35/955 aa) CDS
ENSMUSE00000975355 IKI3 (18/955 aa) CDS
ENSMUSE00000179081 IKI3 (36/955 aa) CDS
ENSMUSE00000179057 IKI3 (39/955 aa) CDS
ENSMUSE00000179105 IKI3 (25/955 aa) CDS
ENSMUSE00000179062 IKI3 (27/955 aa) CDS
ENSMUSE00000179101 IKI3 (27/955 aa) CDS
ENSMUSE00000179095 IKI3 (47/955 aa) CDS
ENSMUSE00000179060 IKI3 (30/955 aa) CDS
ENSMUSE00000179089 IKI3 (50/955 aa) CDS
ENSMUSE00000968878 IKI3 (42/955 aa) CDS
ENSMUSE00001090536 IKI3 (2/955 aa) CDS
ENSMUSE00001029130 CDS
ENSMUSE00000179093 CDS
ENSMUSE00000179067 CDS
ENSMUSE00001069467 CDS
ENSMUSE00001091378 CDS
ENSMUSE00001089758 CDS
ENSMUSE00001046238 CDS
ENSMUSE00001043740 CDS
ENSMUSE00001003051 CDS
ENSMUSE00000822284 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000150002 retained_intron Target region does not overlap transcript
ENSMUST00000171411 retained_intron Target region does not overlap transcript
ENSMUST00000139445 retained_intron Target region does not overlap transcript
ENSMUST00000140595 retained_intron Target region does not overlap transcript
ENSMUST00000126441 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available