IKMC Project Report - KOMP-CSD (ID: 25724)

Glb1l2 MGI:2388283 ENSMUSG00000036395 OTTMUSG00000028780
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000040398 protein_coding No protein product (NMD) view

Predicted translation: 

MPKWSLRRRPGRTLGLLLLLVLSFLVLRRYLNPKVGSCDHEGALRLNWSTLVPLWLQHQRLGLRTKGPDFILEDSIFQIL
GGSIHYFRVPREYWRDRLLKLKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFIQLAAKIGLWVILRPGPYICSEID
LGGLPSWLLQDPDMKLRTTYHGFTKAVDLYFDHLMSRVVPLQYKHGGPIIAVQVENEYGSYNKDRAYMPYIKKCWPPSTY
SRNRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000848792 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000348883 CDS CDS
ENSMUSE00000382058 Glycoside_Hdrlase_35 (41/313 aa) | Glyco_hydro_42_N (24/148 aa) CDS CDS
ENSMUSE00000990746 Glycoside_Hdrlase_35 (24/313 aa) | Glyco_hydro_42_N (24/148 aa) CDS CDS
ENSMUSE00001006564 Glycoside_Hdrlase_35 (33/313 aa) | Glyco_hydro_42_N (33/148 aa) CDS CDS
ENSMUSE00000267808 Glycoside_Hdrlase_35 (37/313 aa) | Glyco_hydro_42_N (37/148 aa) CDS CDS
ENSMUSE00001050502 Glycoside_Hdrlase_35 (31/313 aa) | Glyco_hydro_42_N (31/148 aa) CDS CDS
ENSMUSE00000964614 Glycoside_Hdrlase_35 (28/313 aa) | Glyco_hydro_42_N (2/148 aa) CDS Deleted
ENSMUSE00000267760 Glycoside_Hdrlase_35 (24/313 aa) CDS CDS + stop codon + UTR
ENSMUSE00000267739 Glycoside_Hdrlase_35 (29/313 aa) CDS
ENSMUSE00000537647 Glycoside_Hdrlase_35 (47/313 aa) CDS
ENSMUSE00000267722 Glycoside_Hdrlase_35 (25/313 aa) CDS
ENSMUSE00000428896 CDS
ENSMUSE00000428892 CDS
ENSMUSE00000358174 CDS
ENSMUSE00000267667 CDS
ENSMUSE00000267657 CDS
ENSMUSE00000267647 CDS
ENSMUSE00000428878 CDS
ENSMUSE00000861011 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000066560 protein_coding No protein product (NMD) view

Predicted translation: 

MPKWSLRRRPGRTLGLLLLLVLSFLVLRRLNWSTLVPLWLQHQRLGLRTKGPDFILEDSIFQILGGSIHYFRVPREYWRD
RLLKLKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFIQLAAKIGLWVILRPGPYICSEIDLGGLPSWLLQDPDMKL
RTTYHGFTKAVDLYFDHLMSRVVPLQYKHGGPIIAVQVENEYGSYNKDRAYMPYIKKCWPPSTYSRNRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000851581 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000382058 Glycoside_Hdrlase_35 (41/313 aa) | Glyco_hydro_42_N (24/148 aa) CDS CDS
ENSMUSE00000990746 Glycoside_Hdrlase_35 (24/313 aa) | Glyco_hydro_42_N (24/148 aa) CDS CDS
ENSMUSE00001006564 Glycoside_Hdrlase_35 (33/313 aa) | Glyco_hydro_42_N (33/148 aa) CDS CDS
ENSMUSE00000267808 Glycoside_Hdrlase_35 (37/313 aa) | Glyco_hydro_42_N (37/148 aa) CDS CDS
ENSMUSE00001050502 Glycoside_Hdrlase_35 (31/313 aa) | Glyco_hydro_42_N (31/148 aa) CDS CDS
ENSMUSE00000964614 Glycoside_Hdrlase_35 (28/313 aa) | Glyco_hydro_42_N (2/148 aa) CDS Deleted
ENSMUSE00000267760 Glycoside_Hdrlase_35 (24/313 aa) CDS CDS + stop codon + UTR
ENSMUSE00000267739 Glycoside_Hdrlase_35 (29/313 aa) CDS
ENSMUSE00000537647 Glycoside_Hdrlase_35 (47/313 aa) CDS
ENSMUSE00000267722 Glycoside_Hdrlase_35 (25/313 aa) CDS
ENSMUSE00000428896 CDS
ENSMUSE00000428892 CDS
ENSMUSE00000358174 CDS
ENSMUSE00000267667 CDS
ENSMUSE00000267657 CDS
ENSMUSE00000267647 CDS
ENSMUSE00000428878 CDS
ENSMUSE00000381007 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000162252 protein_coding No protein product (NMD) view

Predicted translation: 

MLNVVSVLFLAAASACSSPAVGPSPGSSAEESHLSRLNWSTLVPLWLQHQRLGLRTKGPDFILEDSIFQILGGSIHYFRV
PREYWRDRLLKLKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFIQLAAKIGLWVILRPGPYICSEIDLGGLPSWLL
QDPDMKLRTTYHGFTKAVDLYFDHLMSRVVPLQYKHGGPIIAVQVENEYGSYNKDRAYMPYIKKCWPPSTYSRNRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000852999 UTR UTR
ENSMUSE00000863915 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000382058 Glycoside_Hdrlase_35 (41/313 aa) | Glyco_hydro_42_N (24/147 aa) CDS CDS
ENSMUSE00000990746 Glycoside_Hdrlase_35 (24/313 aa) | Glyco_hydro_42_N (24/147 aa) CDS CDS
ENSMUSE00001006564 Glycoside_Hdrlase_35 (33/313 aa) | Glyco_hydro_42_N (33/147 aa) CDS CDS
ENSMUSE00000267808 Glycoside_Hdrlase_35 (37/313 aa) | Glyco_hydro_42_N (37/147 aa) CDS CDS
ENSMUSE00001050502 Glycoside_Hdrlase_35 (31/313 aa) | Glyco_hydro_42_N (31/147 aa) CDS CDS
ENSMUSE00000964614 Glycoside_Hdrlase_35 (28/313 aa) | Glyco_hydro_42_N (1/147 aa) CDS Deleted
ENSMUSE00000267760 Glycoside_Hdrlase_35 (24/313 aa) CDS CDS + stop codon + UTR
ENSMUSE00000267739 Glycoside_Hdrlase_35 (29/313 aa) CDS
ENSMUSE00000537647 Glycoside_Hdrlase_35 (47/313 aa) CDS
ENSMUSE00000267722 Glycoside_Hdrlase_35 (25/313 aa) CDS
ENSMUSE00000428896 CDS
ENSMUSE00000428892 CDS
ENSMUSE00000358174 CDS
ENSMUSE00000267667 CDS
ENSMUSE00000267657 CDS
ENSMUSE00000859633 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000162702 protein_coding No protein product (NMD) view

Predicted translation: 

MPKWSLRRRPGRTLGLLLLLVLSFLVLRSWLLQDPDMKLRTTYHGFTKAVDLYFDHLMSRVVPLQYKHGGPIIAVQVENE
YGSYNKDRAYMPYIKKCWPPSTYSRNRS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000856126 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000267808 Glycoside_Hdrlase_35 (36/217 aa) CDS CDS
ENSMUSE00001050502 Glycoside_Hdrlase_35 (31/217 aa) CDS CDS
ENSMUSE00000964614 Glycoside_Hdrlase_35 (28/217 aa) CDS Deleted
ENSMUSE00000267760 Glycoside_Hdrlase_35 (24/217 aa) CDS CDS + stop codon + UTR
ENSMUSE00000267739 Glycoside_Hdrlase_35 (29/217 aa) CDS
ENSMUSE00000537647 Glycoside_Hdrlase_35 (47/217 aa) CDS
ENSMUSE00000267722 Glycoside_Hdrlase_35 (25/217 aa) CDS
ENSMUSE00000428896 CDS
ENSMUSE00000428892 CDS
ENSMUSE00000358174 CDS
ENSMUSE00000267667 CDS
ENSMUSE00000267657 CDS
ENSMUSE00000267647 CDS
ENSMUSE00000428878 CDS
ENSMUSE00000865528 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000162378 nonsense_mediated_decay Target region does not overlap transcript
ENSMUST00000161635 retained_intron No analysis available: incomplete transcript
ENSMUST00000160458 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0161_1_D01 PRPGS00066_A_A12 Glb1l2tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0123_3_G09 PRPGS00066_A_A12 Glb1l2tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0123_3_H09 PRPGS00066_A_A12 Glb1l2tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 47296 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00066_Z_1_A12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47296 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00066_Z_3_A11 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47296 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00066_Z_4_A12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47296 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00066_Z_4_C12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47296 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00066_Z_3_A12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47296 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00066_Z_1_C12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47296 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00066_Z_2_A12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47296 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00066_Z_2_C12 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 47296 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00066_A_A12 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
47296 Knockout First, Reporter-tagged insertion with conditional potential PCS00066_A_A12