IKMC Project Report - EUCOMM (ID: 25979)

Sympk MGI:1915438 ENSMUSG00000023118 OTTMUSG00000022696
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Sympktm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) EPD0069_2_H09 C57BL/6Dnk;C57BL/6Brd-Tyrc-Brd;C57BL/6N view
( about ) 		WTSI/CNB
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000023882 protein_coding No protein product (NMD) view

Predicted translation: 

MASSSGDSVTRRSVASQFFTQEEGPSIDGMTTSERVVDLLNQAALITNDSKITVLKQQAGH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000441621 UTR UTR
ENSMUSE00001055651 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000975681 CDS CDS
ENSMUSE00001092931 CDS Deleted
ENSMUSE00001066577 CDS Deleted
ENSMUSE00001069978 DUF3453 (25/236 aa) CDS CDS + stop codon + UTR
ENSMUSE00001029946 DUF3453 (84/236 aa) CDS
ENSMUSE00000994827 DUF3453 (58/236 aa) CDS
ENSMUSE00001092901 DUF3453 (71/236 aa) CDS
ENSMUSE00001031876 CDS
ENSMUSE00001037604 CDS
ENSMUSE00001000450 CDS
ENSMUSE00001007777 CDS
ENSMUSE00000987694 CDS
ENSMUSE00001083599 CDS
ENSMUSE00000967264 CDS
ENSMUSE00001075555 CDS
ENSMUSE00001043941 CDS
ENSMUSE00001035808 CDS
ENSMUSE00000999745 Symplekin_C (13/183 aa) CDS
ENSMUSE00001066304 Symplekin_C (31/183 aa) CDS
ENSMUSE00000235914 Symplekin_C (35/183 aa) CDS
ENSMUSE00000235906 Symplekin_C (63/183 aa) CDS
ENSMUSE00000974166 Symplekin_C (43/183 aa) CDS
ENSMUSE00001020816 CDS
ENSMUSE00001010245 CDS
ENSMUSE00000235877 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000153976 protein_coding No analysis available: incomplete transcript
ENSMUST00000130328 protein_coding Target region does not overlap transcript
ENSMUST00000146903 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000137287 retained_intron No analysis available: incomplete transcript
ENSMUST00000148861 processed_transcript Target region does not overlap transcript
ENSMUST00000138440 processed_transcript Target region does not overlap transcript
ENSMUST00000131230 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0069_2_H09 PGS00047_A_H01 Sympktm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR pass
order EPD0069_2_E07 PGS00047_A_H01 Sympktm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 42866 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00047_A_3_H01 L1L2_gt0 L3L4_pZero_DTA_kan view
order 42866 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00047_A_4_H01 L1L2_gt0 L3L4_pZero_DTA_kan view
order 42866 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00047_A_2_H01 L1L2_gt0 L3L4_pZero_DTA_kan view
order 42866 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PGS00047_A_H01 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
42866 Knockout-First - Reporter Tagged Insertion PCS00047_A_H01