IKMC Project Report - KOMP-CSD (ID: 26176)

Ube2o MGI:2444266 ENSMUSG00000020802 OTTMUSG00000003902
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). This mutation is of type 'Deletion' (more information on IKMC alleles can be found here). The table below shows the predicted structure of the gene transcripts. Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000082152 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MADPAAPAPAQAQAAAAPTPAAAPAAAAPPPAPATDSASGPSSDSGPEAGSQRLLFSHDLVSGRYRGSVHFGLVRLIHGE
DSDSEGDDDGRGSSGCSEAGGAGHEEGRASPLRRGYVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGT
VIDVNIDCAVKLIGTNCIIYPVNSKDLQHIW

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000575508 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000466514 CDS CDS
ENSMUSE00000519798 CDS CDS
ENSMUSE00001087689 CDS Deleted
ENSMUSE00001001477 CDS Deleted
ENSMUSE00000498754 CDS Deleted
ENSMUSE00000510555 CDS Deleted
ENSMUSE00000473674 CDS Deleted
ENSMUSE00000477492 CDS Deleted
ENSMUSE00000575497 CDS Deleted
ENSMUSE00000396977 CDS Deleted
ENSMUSE00000969201 CDS Deleted
ENSMUSE00001080449 CDS Deleted
ENSMUSE00001008750 CDS Deleted
ENSMUSE00001030588 UBQ-conjugat_E2 (24/133 aa) CDS Deleted
ENSMUSE00001029036 UBQ-conjugat_E2 (68/133 aa) CDS Deleted
ENSMUSE00001029313 UBQ-conjugat_E2 (20/133 aa) CDS Deleted
ENSMUSE00001047121 UBQ-conjugat_E2 (22/133 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000134102 processed_transcript No analysis available: incomplete transcript
ENSMUST00000147851 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 106068 Deletion (Promotor Driven Cassette) PG00142_Z_4_E02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 106068 Deletion (Promotor Driven Cassette) PG00142_Z_1_E02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 106068 Deletion (Promotor Driven Cassette) PG00142_Z_2_E02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
order 106068 Deletion (Promotor Driven Cassette) PG00142_Z_3_E02 L1L2_Pgk_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
106068 Deletion PCS00142_A_E02