IKMC Project Report - EUCOMM (ID: 26301)

3110043O21Rik MGI:1920455 ENSMUSG00000028300 OTTMUSG00000006496
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000108127 protein_coding Residual C-terminal product view

Predicted translation:

MYAPYPTTHIDVDVNTVKQMPPCHEHIYNQRRYMRSELTAFWRATSEEDMAQDTIIYTDESFTPDLNIFQDVLHRDTLVK
AFLDQVFHLKPGLSLRSTFLAQFLLILHRKALTLIKYIEDDTQKGKKPFKSLRNLKIDLDLTAEGDLNIIMALAEKIKPG
LHSFIFGRPFYTSVQERDVLMTF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000675651 UTR UTR
ENSMUSE00001092321 UTR + start codon + CDS Deleted
ENSMUSE00000969449 CDS Deleted
ENSMUSE00001030644 CDS Deleted
ENSMUSE00000233748 CDS Deleted
ENSMUSE00000233736 CDS Deleted
ENSMUSE00000233724 CDS
ENSMUSE00000233714 CDS UTR + start codon + CDS
ENSMUSE00000177975 CDS CDS
ENSMUSE00000233691 CDS CDS
ENSMUSE00000675641 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000084724 protein_coding Residual C-terminal product view

Predicted translation:

MYAPYPTTHIDVDVNTVKQMPPCHEHIYNQRRYMRSELTAFWRATSEEDMAQDTIIYTDESFTPDLNIFQDVLHRDTLVK
AFLDQVFHLKPGLSLRSTFLAQFLLILHRKALTLIKYIEDDT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000527983 UTR UTR
ENSMUSE00001092321 UTR + start codon + CDS Deleted
ENSMUSE00000969449 CDS Deleted
ENSMUSE00001030644 CDS Deleted
ENSMUSE00000233748 CDS Deleted
ENSMUSE00000233736 CDS Deleted
ENSMUSE00000233724 CDS
ENSMUSE00000233714 CDS UTR + start codon + CDS
ENSMUSE00000177975 CDS CDS
ENSMUSE00000675638 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000108126 protein_coding Residual C-terminal product view

Predicted translation:

MYAPYPTTHIDVDVNTVKQMPPCHEHIYNQRRYMRSELTAFWRATSEEDMAQDTIIYTDESFTPDLNIFQDVLHRDTLVK
AFLDQVFHLKPGLSLRSTFLAQFLLILHRKALTLIKYIEDDTQKGKKPFKSLRNLKIDLDLTAEGDLNIIMALAEKIKPG
LHSFIFGRPFYTSVQERDVLMTF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000675643 UTR UTR
ENSMUSE00001074834 UTR + start codon + CDS Deleted
ENSMUSE00001030644 CDS Deleted
ENSMUSE00000233748 CDS Deleted
ENSMUSE00000233736 CDS Deleted
ENSMUSE00000233724 CDS
ENSMUSE00000233714 CDS UTR + start codon + CDS
ENSMUSE00000177975 CDS CDS
ENSMUSE00000233691 CDS CDS
ENSMUSE00000675641 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000156472 retained_intron No analysis available: incomplete transcript
ENSMUST00000149138 processed_transcript No analysis available: incomplete transcript
ENSMUST00000130538 processed_transcript No analysis available: incomplete transcript
ENSMUST00000142628 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available