IKMC Project Report - KOMP-CSD (ID: 26313)

Snx27 MGI:1923992 ENSMUSG00000028136 OTTMUSG00000019563
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000107283 protein_coding No protein product (NMD) view

Predicted translation: 

MADEDGEGIHPSAPHRNGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVS
AVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQA
VPISVPTYKHVEQNGEKFVCVQSESLVRVTSCRNSCLSLMRITMVCLM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000458185 PDZ (59/88 aa) CDS CDS
ENSMUSE00001078738 Phox (11/95 aa) | PDZ (30/88 aa) CDS CDS
ENSMUSE00001024024 Phox (65/95 aa) CDS Deleted
ENSMUSE00001015848 Phox (20/95 aa) CDS CDS
ENSMUSE00001060435 Ras-assoc (26/84 aa) CDS CDS + stop codon + UTR
ENSMUSE00001085003 Ras-assoc (27/84 aa) CDS
ENSMUSE00001024792 Ras-assoc (32/84 aa) CDS
ENSMUSE00001010653 CDS
ENSMUSE00000973126 CDS
ENSMUSE00001061366 CDS
ENSMUSE00000984249 CDS
ENSMUSE00000672577 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000029783 protein_coding No protein product (NMD) view

Predicted translation: 

MADEDGEGIHPSAPHRNGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVS
AVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQA
VPISVPTYKHVEQNGEKFVCVQSESLVRVTSCRNSCLSLMRITMVCLM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000748029 PDZ (59/88 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001078738 Phox (11/95 aa) | PDZ (30/88 aa) CDS CDS
ENSMUSE00001024024 Phox (65/95 aa) CDS Deleted
ENSMUSE00001015848 Phox (20/95 aa) CDS CDS
ENSMUSE00001060435 Ras-assoc (26/84 aa) CDS CDS + stop codon + UTR
ENSMUSE00001085003 Ras-assoc (27/84 aa) CDS
ENSMUSE00001024792 Ras-assoc (32/84 aa) CDS
ENSMUSE00001010653 CDS
ENSMUSE00000973126 CDS
ENSMUSE00001061366 CDS
ENSMUSE00000984249 CDS
ENSMUSE00000496809 Phox (2/95 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000107281 protein_coding No protein product (NMD) view

Predicted translation: 

MGLFFSLFPLRNGVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPTYKHV
EQNGEKFVCVQSESLVRVTSCRNSCLSLMRITMVCLM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000672572 Phox (11/95 aa) CDS CDS
ENSMUSE00001024024 Phox (65/95 aa) CDS Deleted
ENSMUSE00001015848 Phox (20/95 aa) CDS CDS
ENSMUSE00001060435 Ras-assoc (26/84 aa) CDS CDS + stop codon + UTR
ENSMUSE00001085003 Ras-assoc (27/84 aa) CDS
ENSMUSE00001024792 Ras-assoc (32/84 aa) CDS
ENSMUSE00001010653 CDS
ENSMUSE00000973126 CDS
ENSMUSE00001061366 CDS
ENSMUSE00000984249 CDS
ENSMUSE00001059780 Phox (2/95 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000143860 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MADEDGEGIHPSAPHRNGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQERREC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000818747 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001039789 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001079861 UTR Deleted
ENSMUSE00000986704 UTR UTR
ENSMUSE00001063518 UTR UTR
ENSMUSE00000977676 UTR UTR
ENSMUSE00001089864 UTR UTR
ENSMUSE00001052876 UTR UTR
ENSMUSE00001062868 UTR UTR
ENSMUSE00000983968 UTR UTR
ENSMUSE00001081928 UTR UTR
ENSMUSE00000757911 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000140176 nonsense_mediated_decay No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available