IKMC Project Report - KOMP-CSD (ID: 26418)

Lox MGI:96817 ENSMUSG00000024529
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000171470 protein_coding No protein product (NMD) view

Predicted translation: 

MRFAWAVLLLGPLQLCPLLRCAPQTPREPPAAPGAWRQTIQWENNGQVFSLLSLGAQYQPQRRRDPSATARRPDGDAASQ
PRTPILLLRDNRTASTRARTPSPSGVAAGRPRPAARHWFQAGFSPSGARDGASRRAANRTASPQPPQLSNLRPPSHIDRM
VGDDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLA
RD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000896930 UTR UTR
ENSMUSE00000886583 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000143091 Lysyl_oxidase (34/204 aa) CDS CDS
ENSMUSE00000143090 Lysyl_oxidase (47/204 aa) CDS Deleted
ENSMUSE00000572522 Lysyl_oxidase (53/204 aa) CDS Deleted
ENSMUSE00000572521 Lysyl_oxidase (32/204 aa) CDS CDS + stop codon + UTR
ENSMUSE00000339262 Lysyl_oxidase (39/204 aa) CDS
ENSMUSE00000912081 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000025409 protein_coding No protein product (NMD) view

Predicted translation: 

MRFAWAVLLLGPLQLCPLLRCAPQTPREPPAAPGAWRQTIQWENNGQVFSLLSLGAQYQPQRRRDPSATARRPDGDAASQ
PRTPILLLRDNRTASTRARTPSPSGVAAGRPRPAARHWFQAGFSPSGARDGASRRAANRTASPQPPQLSNLRPPSHIDRM
VGDDPYNPYKYSDDNPYYNYYDTYERPRPGSRNRPGYGTGYFQYGLPDLVPDPYYIQASTYVQKMSMYNLRCAAEENCLA
RD*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000358120 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000143091 Lysyl_oxidase (34/204 aa) CDS CDS
ENSMUSE00000143090 Lysyl_oxidase (47/204 aa) CDS Deleted
ENSMUSE00000572522 Lysyl_oxidase (53/204 aa) CDS Deleted
ENSMUSE00000572521 Lysyl_oxidase (32/204 aa) CDS CDS + stop codon + UTR
ENSMUSE00000339262 Lysyl_oxidase (39/204 aa) CDS
ENSMUSE00000981817 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0813_3_B03 PG00097_Z_2_E10 Loxtm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR fail 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0813_3_F02 PG00097_Z_2_E10 Loxtm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR fail 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0813_3_E03 PG00097_Z_2_E10 Loxtm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number fail Cells Thawed Correctly -
5' LR-PCR fail 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 96442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00097_Z_2_E10 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 96442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00097_Z_4_E10 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 96442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00097_Z_3_E10 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 96442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00097_A_E10 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
96442 Knockout First, Reporter-tagged insertion with conditional potential PCS00097_A_E10