IKMC Project Report - (ID: 26799)

non-BioMart die(): Cannot write to '/nfs/team87/services/biomart/ikmc-mart/production/server/releases/20110531105342/logs/log4perl_log': at /software/team87/brave_new_world/lib/perl5/Log/Log4perl/Appender/File.pm line 245.
Pre-pipeline Designs Vectors ES Cells Mice

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000080407 protein_coding Novel C-terminal product view

Predicted translation: 

MVFLTYIERSSGNIELAVKSMKYVIMKMICSHFYSWMLL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000676869 UTR + start codon + CDS
ENSMUSE00001093709 Krueppel-associated_box (40/41 aa) CDS Deleted
ENSMUSE00000967946 Krueppel-associated_box (2/41 aa) CDS Deleted
ENSMUSE00000650890 Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000149560 processed_transcript No analysis available: incomplete transcript
ENSMUST00000145996 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available