IKMC Project Report - KOMP-CSD (ID: 26810)

Aatk MGI:1197518 ENSMUSG00000025375 OTTMUSG00000004053
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) EPD0731_1_D11 C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000103020 protein_coding No protein product (NMD) view

Predicted translation: 

MLACLCCKKGGIGFKEFENAEGDEYVADFSEQGSPAAAAQTGPDVYVLPLTEVSLPMAKQPGRSVTWP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000661044 UTR UTR
ENSMUSE00000981312 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001088231 CDS CDS
ENSMUSE00001038563 Ser-Thr/Tyr_kinase_cat_dom (10/266 aa) | Prot_kinase_cat_dom (10/264 aa) CDS Deleted
ENSMUSE00000971852 Ser-Thr/Tyr_kinase_cat_dom (40/266 aa) | Prot_kinase_cat_dom (40/264 aa) CDS Deleted
ENSMUSE00001016504 Ser-Thr/Tyr_kinase_cat_dom (30/266 aa) | Prot_kinase_cat_dom (30/264 aa) CDS Deleted
ENSMUSE00001043208 Ser-Thr/Tyr_kinase_cat_dom (45/266 aa) | Prot_kinase_cat_dom (45/264 aa) CDS Deleted
ENSMUSE00001078337 Ser-Thr/Tyr_kinase_cat_dom (29/266 aa) | Prot_kinase_cat_dom (29/264 aa) CDS CDS + stop codon + UTR
ENSMUSE00001068430 Ser-Thr/Tyr_kinase_cat_dom (41/266 aa) | Prot_kinase_cat_dom (41/264 aa) CDS
ENSMUSE00001090915 Ser-Thr/Tyr_kinase_cat_dom (51/266 aa) | Prot_kinase_cat_dom (51/264 aa) CDS
ENSMUSE00000315686 Ser-Thr/Tyr_kinase_cat_dom (24/266 aa) | Prot_kinase_cat_dom (22/264 aa) CDS
ENSMUSE00000971291 CDS
ENSMUSE00000150294 CDS
ENSMUSE00000421410 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000103019 protein_coding No protein product (NMD) view

Predicted translation: 

MLACLCCKKGGIGFKEFENAEGDEYVADFSEQGSPAAAAQTGPDVYVLPLTEVSLPMAKQPGRSVTWP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000661042 UTR UTR
ENSMUSE00000981312 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001088231 CDS CDS
ENSMUSE00001038563 Ser-Thr/Tyr_kinase_cat_dom (10/266 aa) | Prot_kinase_cat_dom (10/264 aa) CDS Deleted
ENSMUSE00000971852 Ser-Thr/Tyr_kinase_cat_dom (40/266 aa) | Prot_kinase_cat_dom (40/264 aa) CDS Deleted
ENSMUSE00001016504 Ser-Thr/Tyr_kinase_cat_dom (30/266 aa) | Prot_kinase_cat_dom (30/264 aa) CDS Deleted
ENSMUSE00001043208 Ser-Thr/Tyr_kinase_cat_dom (45/266 aa) | Prot_kinase_cat_dom (45/264 aa) CDS Deleted
ENSMUSE00001078337 Ser-Thr/Tyr_kinase_cat_dom (29/266 aa) | Prot_kinase_cat_dom (29/264 aa) CDS CDS + stop codon + UTR
ENSMUSE00001068430 Ser-Thr/Tyr_kinase_cat_dom (41/266 aa) | Prot_kinase_cat_dom (41/264 aa) CDS
ENSMUSE00001090915 Ser-Thr/Tyr_kinase_cat_dom (51/266 aa) | Prot_kinase_cat_dom (51/264 aa) CDS
ENSMUSE00000315686 Ser-Thr/Tyr_kinase_cat_dom (24/266 aa) | Prot_kinase_cat_dom (22/264 aa) CDS
ENSMUSE00000971291 CDS
ENSMUSE00000150294 CDS
ENSMUSE00000421410 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000064307 protein_coding No protein product (NMD) view

Predicted translation: 

MLIALLALAMSSSFFNPSFAFSSHFDPDGAPLSELSWSSSLAVVAVSFSGIFTVVILMLACLCCKKGGIGFKEFENAEGD
EYVADFSEQGSPAAAAQTGPDVYVLPLTEVSLPMAKQPGRSVTWP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000421441 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001013206 CDS CDS
ENSMUSE00001088231 CDS CDS
ENSMUSE00001038563 Ser-Thr/Tyr_kinase_cat_dom (10/266 aa) | Prot_kinase_cat_dom (10/264 aa) CDS Deleted
ENSMUSE00000971852 Ser-Thr/Tyr_kinase_cat_dom (40/266 aa) | Prot_kinase_cat_dom (40/264 aa) CDS Deleted
ENSMUSE00001016504 Ser-Thr/Tyr_kinase_cat_dom (30/266 aa) | Prot_kinase_cat_dom (30/264 aa) CDS Deleted
ENSMUSE00001043208 Ser-Thr/Tyr_kinase_cat_dom (45/266 aa) | Prot_kinase_cat_dom (45/264 aa) CDS Deleted
ENSMUSE00001078337 Ser-Thr/Tyr_kinase_cat_dom (29/266 aa) | Prot_kinase_cat_dom (29/264 aa) CDS CDS + stop codon + UTR
ENSMUSE00001068430 Ser-Thr/Tyr_kinase_cat_dom (41/266 aa) | Prot_kinase_cat_dom (41/264 aa) CDS
ENSMUSE00001090915 Ser-Thr/Tyr_kinase_cat_dom (51/266 aa) | Prot_kinase_cat_dom (51/264 aa) CDS
ENSMUSE00000315686 Ser-Thr/Tyr_kinase_cat_dom (24/266 aa) | Prot_kinase_cat_dom (22/264 aa) CDS
ENSMUSE00000971291 CDS
ENSMUSE00000150294 CDS
ENSMUSE00000575054 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000150730 processed_transcript No analysis available: incomplete transcript
ENSMUST00000142959 processed_transcript Target region does not overlap transcript
ENSMUST00000132575 processed_transcript No analysis available: incomplete transcript
ENSMUST00000136386 processed_transcript No analysis available: incomplete transcript
ENSMUST00000128836 processed_transcript No analysis available: incomplete transcript
ENSMUST00000134319 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0731_1_D11 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_A09 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_C10 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_C11 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_C12 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_D10 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_E09 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_E10 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_E11 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_G10 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_G11 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_G12 PG00028_Y_6_B07 Aatktm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0731_1_A10 PG00028_Y_6_B07 Aatktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0731_1_G09 PG00028_Y_6_B07 Aatktm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 41505 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00028_Y_6_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 41505 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00028_Y_5_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 41505 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00028_Y_7_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 41505 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00028_A_B07 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
41505 Knockout-First - Reporter Tagged Insertion PCS00028_A_B07