IKMC Project Report - KOMP-CSD (ID: 26926)

Polrmt MGI:1915843 ENSMUSG00000020329 OTTMUSG00000027870
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 13 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000020580 protein_coding No protein product (NMD) view

Predicted translation: 

MSALRWTRSAAGLGRVLRSPGPHRPPSEEGTFGGFCSSRRSSAASPREQHVLREWGHAELLEGLLQRAGLCVPHAEGCWP
LPRPVLLCSCTPVHGTQGPGCSHHPEVSEADDGRRLPAPAALH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000868671 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001067760 CDS CDS
ENSMUSE00000979599 CDS Deleted
ENSMUSE00001056464 CDS CDS
ENSMUSE00001007369 CDS CDS + stop codon + UTR
ENSMUSE00001003726 CDS
ENSMUSE00001040949 CDS
ENSMUSE00000966574 CDS
ENSMUSE00001008913 CDS
ENSMUSE00001005308 DNA-dir_Rpol_phage-type (49/406 aa) CDS
ENSMUSE00001045551 DNA-dir_Rpol_phage-type (41/406 aa) CDS
ENSMUSE00001089377 DNA-dir_Rpol_phage-type (41/406 aa) CDS
ENSMUSE00000990302 DNA-dir_Rpol_phage-type (60/406 aa) CDS
ENSMUSE00001052576 DNA-dir_Rpol_phage-type (29/406 aa) CDS
ENSMUSE00001083119 DNA-dir_Rpol_phage-type (38/406 aa) CDS
ENSMUSE00000969588 DNA-dir_Rpol_phage-type (18/406 aa) CDS
ENSMUSE00001081911 DNA-dir_Rpol_phage-type (34/406 aa) CDS
ENSMUSE00000975030 DNA-dir_Rpol_phage-type (25/406 aa) CDS
ENSMUSE00000984420 DNA-dir_Rpol_phage-type (31/406 aa) CDS
ENSMUSE00001022924 DNA-dir_Rpol_phage-type (27/406 aa) CDS
ENSMUSE00000370982 DNA-dir_Rpol_phage-type (16/406 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000159016 protein_coding No protein product (NMD) view

Predicted translation: 

MSALRWTRSAAGLGRVLRSPGPHRPPSEEGTFGGFCSSRRSSAASPREQHVLREWGHAELLEGLLQRAGLCVPHAEGCWP
LPRPVLLCSCTPVHGTQGPGCSHHPEVSEADDGRRLPAPAALH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000849006 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001067760 CDS CDS
ENSMUSE00000979599 CDS Deleted
ENSMUSE00001056464 CDS CDS
ENSMUSE00001007369 CDS CDS + stop codon + UTR
ENSMUSE00001003726 CDS
ENSMUSE00001040949 CDS
ENSMUSE00000966574 CDS
ENSMUSE00001005308 DNA-dir_Rpol_phage-type (49/406 aa) CDS
ENSMUSE00001045551 DNA-dir_Rpol_phage-type (41/406 aa) CDS
ENSMUSE00001089377 DNA-dir_Rpol_phage-type (41/406 aa) CDS
ENSMUSE00000990302 DNA-dir_Rpol_phage-type (60/406 aa) CDS
ENSMUSE00001052576 DNA-dir_Rpol_phage-type (29/406 aa) CDS
ENSMUSE00001083119 DNA-dir_Rpol_phage-type (38/406 aa) CDS
ENSMUSE00000969588 DNA-dir_Rpol_phage-type (18/406 aa) CDS
ENSMUSE00001081911 DNA-dir_Rpol_phage-type (34/406 aa) CDS
ENSMUSE00000975030 DNA-dir_Rpol_phage-type (25/406 aa) CDS
ENSMUSE00000984420 DNA-dir_Rpol_phage-type (31/406 aa) CDS
ENSMUSE00001022924 DNA-dir_Rpol_phage-type (27/406 aa) CDS
ENSMUSE00000370982 DNA-dir_Rpol_phage-type (16/406 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000161662 protein_coding Target region does not overlap transcript
ENSMUST00000162694 nonsense_mediated_decay No protein product (NMD) view

Predicted translation: 

MSALRWTRSAAGLGRVLRSPGPHRPPSEEGTFGGFCSSRRSSAASPREQHVLREWGHAELLEGLLQRAGLCVPHAEGCWP
LPRPVLLCSCTPVHGTQGPGCSHHPEVSEADDGRRLPAPAALH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000849364 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001067760 CDS CDS
ENSMUSE00000979599 CDS Deleted
ENSMUSE00001056464 CDS CDS
ENSMUSE00001007369 CDS CDS + stop codon + UTR
ENSMUSE00001003726 CDS
ENSMUSE00001040949 CDS
ENSMUSE00000966574 CDS
ENSMUSE00001008913 CDS
ENSMUSE00001005308 DNA-dir_Rpol_phage-type (49/91 aa) CDS
ENSMUSE00001045551 DNA-dir_Rpol_phage-type (41/91 aa) CDS
ENSMUSE00000862245 DNA-dir_Rpol_phage-type (1/91 aa) CDS + stop codon + UTR
ENSMUSE00000968481 UTR UTR
ENSMUSE00000848234 UTR UTR
ENSMUSE00000981251 UTR UTR
ENSMUSE00000978670 UTR UTR
ENSMUSE00001032019 UTR UTR
ENSMUSE00001023731 UTR UTR
ENSMUSE00000964636 UTR UTR
ENSMUSE00000855150 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000161765 retained_intron No analysis available: incomplete transcript
ENSMUST00000159082 retained_intron No analysis available: incomplete transcript
ENSMUST00000162687 retained_intron Target region does not overlap transcript
ENSMUST00000161098 retained_intron Target region does not overlap transcript
ENSMUST00000160838 retained_intron Target region does not overlap transcript
ENSMUST00000162679 retained_intron Target region does not overlap transcript
ENSMUST00000161375 processed_transcript No analysis available: incomplete transcript
ENSMUST00000159289 retained_intron Target region does not overlap transcript
ENSMUST00000160595 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0770_3_A07 PG00059_Z_3_G07 Polrmttm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0770_3_C06 PG00059_Z_3_G07 Polrmttm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) pass Vector Integrity pass
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0770_3_G06 PG00059_Z_3_G07 Polrmttm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0770_3_D06 PG00059_Z_3_G07 Polrmttm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) fail Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0770_3_E07 PG00059_Z_3_G07 Polrmttm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0770_3_F05 PG00059_Z_3_G07 Polrmttm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0770_3_H06 PG00059_Z_3_G07 Polrmttm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0770_3_B05 PG00059_Z_3_G07 Polrmttm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0770_3_E06 PG00059_Z_3_G07 Polrmttm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0770_3_B08 PG00059_Z_3_G07 Polrmttm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0106_1_B12 PRPGS00059_A_G07 Polrmttm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0106_1_G12 PRPGS00059_A_G07 Polrmttm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0106_1_H12 PRPGS00059_A_G07 Polrmttm2e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen no reads detected 3' Screen no reads detected
Loss of WT Allele (LOA) pass Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 46041 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00059_Z_3_G07 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46041 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00059_A_G07 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
46041 Knockout-First - Reporter Tagged Insertion PCS00059_A_G07