IKMC Project Report - EUCOMM (ID: 26927)

Btbd11 MGI:1921257 ENSMUSG00000020042 OTTMUSG00000017451
Pre-pipeline Designs Vectors ES Cells Mice
Vector Construction in Progress

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000105307 protein_coding No protein product (NMD) view

Predicted translation:

MARRGKKPVVRTLEDLTLDSGYGGAADSVRSSNLSLCCSDSHPASPYGGSCWPPLADSMHSRHNSFDTVNTALVEDSEGL
DCAGQHCSRLLPDLDEVPWTLQELELLLLRSRDPRAGPAVPGSLPKDALAKLSMLVSRALVRIAKEAQRLSLRFAKCTKY
EIQSAMEIVLSWGLAAHCTAAALAALSLYNMSSAGGDRLGRGKSARCGLTFSVGRVYRWMVDSRVALRIHEHAAIYLTAC
MESLFRDIYSRVLASGLPRSCSGPGPGSSSGSGPGPGSGPGAPAADKERETPGGGAASGGPCSAASSASGGSSCCAPPAT
AATAVPPTTATAAVAANHHHHHHTLHEAPKFTVETLEHTVNNDSEIWGLLQPYQHLICGKNASGVLSLPESLNLHRDPQR
PSKPGELPMFSQSELRTIEQSLLATRVGSIAELSDLVSRAMHHLQPLNAKHHGNGTPMHHKQGALYWEPEALYTLCYFMH
CPQMEWENPNVEPSKVNLQVERPFLVLPPLMEWIRVAVAHAGHRRSFSMDSDDVRQAARLLLPGVDCEPRQLKV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000574431 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000574430 CDS CDS
ENSMUSE00000574429 CDS CDS
ENSMUSE00001020804 CDS CDS
ENSMUSE00000459019 CDS Deleted
ENSMUSE00000459015 Ankyrin_rpt (29/29 aa) CDS CDS + stop codon + UTR
ENSMUSE00000459008 Ankyrin_rpt (16/26 aa) CDS
ENSMUSE00000251981 Ankyrin_rpt (10/26 aa) | Ankyrin_rpt (10/28 aa) CDS
ENSMUSE00001026286 Ankyrin_rpt (19/28 aa) CDS
ENSMUSE00000974025 CDS
ENSMUSE00001080354 CDS
ENSMUSE00001053423 CDS
ENSMUSE00001041563 BTB_POZ (31/105 aa) CDS
ENSMUSE00001009705 BTB_POZ (28/105 aa) CDS
ENSMUSE00001002995 BTB_POZ (23/105 aa) CDS
ENSMUSE00000991123 BTB_POZ (24/105 aa) CDS
ENSMUSE00000982779 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000105306 protein_coding No protein product (NMD) view

Predicted translation:

MRKPRPRESREPDPGSPVGSGCLQRLSHSGVSRPFLVLPPLMEWIRVAVAHAGHRRSFSMDSDDVRQAARLLLPGVDCEP
RQLKV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000757283 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001020804 CDS CDS
ENSMUSE00000459019 CDS Deleted
ENSMUSE00000459015 Ankyrin_rpt (29/29 aa) CDS CDS + stop codon + UTR
ENSMUSE00000459008 Ankyrin_rpt (16/26 aa) CDS
ENSMUSE00000251981 Ankyrin_rpt (10/26 aa) | Ankyrin_rpt (10/28 aa) CDS
ENSMUSE00001026286 Ankyrin_rpt (19/28 aa) CDS
ENSMUSE00000974025 CDS
ENSMUSE00001080354 CDS
ENSMUSE00001053423 CDS
ENSMUSE00001041563 BTB_POZ (31/105 aa) CDS
ENSMUSE00001009705 BTB_POZ (28/105 aa) CDS
ENSMUSE00001002995 BTB_POZ (23/105 aa) CDS
ENSMUSE00000991123 BTB_POZ (24/105 aa) CDS
ENSMUSE00000982779 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000020231 protein_coding No analysis available: incomplete transcript
ENSMUST00000145323 retained_intron Target region does not overlap transcript
ENSMUST00000128338 processed_transcript Target region does not overlap transcript
ENSMUST00000156123 retained_intron Target region does not overlap transcript
ENSMUST00000135235 processed_transcript Target region does not overlap transcript
ENSMUST00000145433 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available