IKMC Project Report - KOMP-CSD (ID: 26949)

Pbdc1 MGI:1914933 ENSMUSG00000031226 OTTMUSG00000018113
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000033577 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation:

MDAAGESEEPVSGEALSIAHALSHPPESYGND

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000862732 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000207476 CDS CDS
ENSMUSE00000207477 Put_polysacc_synth (17/120 aa) CDS Deleted
ENSMUSE00000207482 Put_polysacc_synth (47/120 aa) CDS Deleted
ENSMUSE00000283050 Put_polysacc_synth (38/120 aa) CDS Deleted
ENSMUSE00000405029 Put_polysacc_synth (19/120 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000119477 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MDAAGESEEPVSGEALSIAHALSHPPESYGNDHESPFTDEVPSSSLAS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000712501 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000207476 CDS CDS
ENSMUSE00000207477 Put_polysacc_synth (17/102 aa) CDS Deleted
ENSMUSE00000207482 Put_polysacc_synth (47/102 aa) CDS Deleted
ENSMUSE00000283050 Put_polysacc_synth (38/102 aa) CDS Deleted
ENSMUSE00000718886 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000125343 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available