IKMC Project Report - KOMP-CSD (ID: 27143)

Pof1b MGI:1916943 ENSMUSG00000034607 OTTMUSG00000018382
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000039887 protein_coding No protein product (NMD) view

Predicted translation:

MMSSSYWSETSSSSCGTQQPTEVLQCQPQHYHYYHQPSQAQQPPEKNVVYERVRTYSGPMNKVVQALDPLGSREVLSPLK
PASSYQSLVWSDHSQELYSPTLKISTCAPSTLHITQNAEQELHSPTVKVTTYPQTTIRRYIVQNPEQEPLSPFLRGSQFF
PGNNVIYEKTIRKVEKLNTDQECCPQIQCHHHVIQQPQIIHSPHCQQSHSSHQIQCITENDSNIGHELCHGGPSQIHEQQ
TRF*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000420510 UTR UTR
ENSMUSE00000335898 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000295341 CDS CDS
ENSMUSE00000295332 CDS CDS
ENSMUSE00000295321 CDS CDS
ENSMUSE00000295316 CDS CDS
ENSMUSE00000295310 CDS Deleted
ENSMUSE00000295303 CDS CDS + stop codon + UTR
ENSMUSE00000295296 CDS
ENSMUSE00000295285 CDS
ENSMUSE00000295275 CDS
ENSMUSE00000295264 CDS
ENSMUSE00000295255 CDS
ENSMUSE00000295246 CDS
ENSMUSE00000295239 CDS
ENSMUSE00000380503 CDS
ENSMUSE00000340288 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available