IKMC Project Report - EUCOMM (ID: 27588)

Adam19 MGI:105377 ENSMUSG00000011256 OTTMUSG00000005488
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Adam19tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) HEPD0536_5_C08 C57BL/6NTac;C57BL/6NTac;C57BL/6N view
( about ) 		Monterotondo
Southern Blot na TV Backbone Assay na 5' LR-PCR na
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) na
LacZ SR-PCR na 5' Cassette Integrity Neo SR-PCR pass
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000011400 protein_coding No protein product (NMD) view

Predicted translation: 

MPGRAGVARFCLLALALQLHWPLAACEPGWTTRGSQEGSPPLQHELIIPQWRTSESPGRGKAPFCSSLHRNLLHCKWQSS
NQHAEV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000679628 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000975295 Peptidase_M12B_N (26/129 aa) CDS CDS
ENSMUSE00000995966 Peptidase_M12B_N (24/129 aa) CDS Deleted
ENSMUSE00000104363 Peptidase_M12B_N (27/129 aa) CDS CDS + stop codon + UTR
ENSMUSE00000104327 Peptidase_M12B_N (26/129 aa) CDS
ENSMUSE00000104368 Peptidase_M12B_N (28/129 aa) CDS
ENSMUSE00000104331 Peptidase_M12B (12/199 aa) CDS
ENSMUSE00000104330 Peptidase_M12B (24/199 aa) CDS
ENSMUSE00000104343 Peptidase_M12B (56/199 aa) CDS
ENSMUSE00000104360 Peptidase_M12B (29/199 aa) CDS
ENSMUSE00000104370 Peptidase_M12B (47/199 aa) CDS
ENSMUSE00000104358 Peptidase_M12B (33/199 aa) | Blood-coag_inhib_Disintegrin (11/75 aa) CDS
ENSMUSE00001053659 Blood-coag_inhib_Disintegrin (30/75 aa) CDS
ENSMUSE00000992625 ADAM_Cys-rich (30/116 aa) | Blood-coag_inhib_Disintegrin (34/75 aa) CDS
ENSMUSE00001021915 ADAM_Cys-rich (37/116 aa) CDS
ENSMUSE00000994118 ADAM_Cys-rich (51/116 aa) CDS
ENSMUSE00000970230 CDS
ENSMUSE00001051940 CDS
ENSMUSE00001054668 CDS
ENSMUSE00001046746 CDS
ENSMUSE00000996647 CDS
ENSMUSE00001010293 CDS
ENSMUSE00000335467 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000151565 processed_transcript Target region does not overlap transcript
ENSMUST00000153410 retained_intron Target region does not overlap transcript
ENSMUST00000137014 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0536_5_C08 PGS00064_A_H11 Adam19tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot pass Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR pass Mutant Specific SR-PCR pass LoxP Confirmation pass
3' LR-PCR -
order HEPD0536_5_D09 PGS00064_A_H11 Adam19tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0536_5_G07 PGS00064_A_H11 Adam19tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0536_5_G09 PGS00064_A_H11 Adam19tm1a(EUCOMM)Hmgu Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order HEPD0536_5_A08 PGS00064_A_H11 Adam19tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0536_5_B08 PGS00064_A_H11 Adam19tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0536_5_D07 PGS00064_A_H11 Adam19tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0536_5_H08 PGS00064_A_H11 Adam19tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotorless Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 47343 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PG00064_A_4_H11 L1L2_st0 L3L4_pZero_DTA_kan view
order 47343 Knockout-First - Reporter Tagged Insertion (Promotorless Cassette) PGS00064_A_H11 L1L2_st0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
47343 Knockout-First - Reporter Tagged Insertion PCS00064_A_H11