IKMC Project Report - EUCOMM (ID: 27676)

Dlg2 MGI:1344351 ENSMUSG00000052572 OTTMUSG00000016974
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Dlg2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) EPD0635_5_E12 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI/Monterotondo
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000107196 protein_coding No protein product (NMD) view

Predicted translation: 

MFFACYCALRTNVKKYRYQDEDGPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKASPAPIIVNTDT
LDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSE
VSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQ
VGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLP
PISPGRYSPIPKHMLGEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPYPHYHLGLLPDSDMTSHSQHST
ATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASH
EQAAAALKGAGQTVTIIAQYQPEEPCLTMTRARTVGCPAKDLVLNMETSFMSSMPLMMSGGKPEGSH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000807436 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001033865 MAGUK_PEST_N (54/84 aa) CDS CDS
ENSMUSE00001093879 MAGUK_PEST_N (18/84 aa) CDS CDS
ENSMUSE00001036320 PDZ (5/84 aa) | MAGUK_PEST_N (12/84 aa) CDS CDS
ENSMUSE00001073511 PDZ (42/84 aa) CDS CDS
ENSMUSE00001030386 PDZ (38/84 aa) | PDZ (8/83 aa) CDS CDS
ENSMUSE00001051551 PDZ (46/83 aa) CDS CDS
ENSMUSE00000978248 PDZ (30/83 aa) | PDZ_assoc (18/68 aa) CDS CDS
ENSMUSE00000985550 PDZ_assoc (47/68 aa) CDS CDS
ENSMUSE00001044719 PDZ_assoc (5/68 aa) CDS CDS
ENSMUSE00000980640 CDS CDS
ENSMUSE00001078226 PDZ (47/76 aa) CDS CDS
ENSMUSE00001082972 PDZ (29/76 aa) CDS CDS
ENSMUSE00001062627 SH3_2 (2/61 aa) CDS Deleted
ENSMUSE00001069241 SH3_2 (60/61 aa) | SH3_domain (57/57 aa) CDS CDS + stop codon + UTR
ENSMUSE00001066506 SH3_2 (1/61 aa) CDS
ENSMUSE00001089667 CDS
ENSMUSE00001050241 CDS
ENSMUSE00000995213 Guanylate_kin (31/177 aa) CDS
ENSMUSE00001085367 Guanylate_kin (58/177 aa) CDS
ENSMUSE00001016750 Guanylate_kin (37/177 aa) CDS
ENSMUSE00000993832 Guanylate_kin (32/177 aa) CDS
ENSMUSE00000464440 Guanylate_kin (22/177 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000074273 protein_coding No protein product (NMD) view

Predicted translation: 

MFFACYCALRTNVKKYRYQDEDGPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKASPAPIIVNTDT
LDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSE
VSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQ
VGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLP
PISPGRYSPIPKHMLGEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPYPHYHLGLLPDSDMTSHSQHST
ATRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASH
EQAAAALKGAGQTVTIIAQYQPEEPCLTMTRARTVGCPAKDLVLNMETSFMSSMPLMMSGGKPEGSH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000672371 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001033865 MAGUK_PEST_N (54/84 aa) CDS CDS
ENSMUSE00001093879 MAGUK_PEST_N (18/84 aa) CDS CDS
ENSMUSE00001036320 PDZ (5/84 aa) | MAGUK_PEST_N (12/84 aa) CDS CDS
ENSMUSE00001073511 PDZ (42/84 aa) CDS CDS
ENSMUSE00001030386 PDZ (38/84 aa) | PDZ (8/83 aa) CDS CDS
ENSMUSE00001051551 PDZ (46/83 aa) CDS CDS
ENSMUSE00000978248 PDZ (30/83 aa) | PDZ_assoc (18/68 aa) CDS CDS
ENSMUSE00000985550 PDZ_assoc (47/68 aa) CDS CDS
ENSMUSE00001044719 PDZ_assoc (5/68 aa) CDS CDS
ENSMUSE00000980640 CDS CDS
ENSMUSE00001078226 PDZ (47/76 aa) CDS CDS
ENSMUSE00001082972 PDZ (29/76 aa) CDS CDS
ENSMUSE00001062627 SH3_2 (2/61 aa) CDS Deleted
ENSMUSE00001069241 SH3_2 (60/61 aa) | SH3_domain (57/57 aa) CDS CDS + stop codon + UTR
ENSMUSE00001066506 SH3_2 (1/61 aa) CDS
ENSMUSE00000633671 CDS
ENSMUSE00001050241 CDS
ENSMUSE00000995213 Guanylate_kin (31/177 aa) CDS
ENSMUSE00001085367 Guanylate_kin (58/177 aa) CDS
ENSMUSE00001016750 Guanylate_kin (37/177 aa) CDS
ENSMUSE00000993832 Guanylate_kin (32/177 aa) CDS
ENSMUSE00000464440 Guanylate_kin (22/177 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000107193 protein_coding No protein product (NMD) view

Predicted translation: 

MLPTFDMQRPSASRAENYQLLWDTIASLKQCEEAMQHAFIPVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDP
GIFITKIIPGGAAAEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGF
SIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNTSDVVYLKVGKPTTIYMT
DPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLGEDDYTSHSQHSTATRQPSVTLQRAISLEG
EPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTII
AQYQPEEPCLTMTRARTVGCPAKDLVLNMETSFMSSMPLMMSGGKPEGSH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000672367 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001036320 PDZ (5/84 aa) CDS CDS
ENSMUSE00001073511 PDZ (42/84 aa) CDS CDS
ENSMUSE00001030386 PDZ (38/84 aa) | PDZ (8/83 aa) CDS CDS
ENSMUSE00001051551 PDZ (46/83 aa) CDS CDS
ENSMUSE00000978248 PDZ (30/83 aa) | PDZ_assoc (18/64 aa) CDS CDS
ENSMUSE00000985550 PDZ_assoc (47/64 aa) CDS CDS
ENSMUSE00000980640 PDZ_assoc (1/64 aa) CDS CDS
ENSMUSE00001078226 PDZ (47/76 aa) CDS CDS
ENSMUSE00001082972 PDZ (29/76 aa) CDS CDS
ENSMUSE00001062627 SH3_2 (2/61 aa) CDS Deleted
ENSMUSE00001069241 SH3_2 (60/61 aa) | SH3_domain (57/57 aa) CDS CDS + stop codon + UTR
ENSMUSE00001066506 SH3_2 (1/61 aa) CDS
ENSMUSE00001089667 CDS
ENSMUSE00001050241 CDS
ENSMUSE00000995213 Guanylate_kin (31/177 aa) CDS
ENSMUSE00001085367 Guanylate_kin (58/177 aa) CDS
ENSMUSE00001016750 Guanylate_kin (37/177 aa) CDS
ENSMUSE00000993832 Guanylate_kin (32/177 aa) CDS
ENSMUSE00000464440 Guanylate_kin (22/177 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000098308 protein_coding No protein product (NMD) view

Predicted translation: 

MSSQRWELKGWLPWEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQA
AAALKGAGQTVTIIAQYQPEEPCLTMTRARTVGCPAKDLVLNMETSFMSSMPLMMSGGKPEGSH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000672366 UTR UTR
ENSMUSE00000672365 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001078226 PDZ (47/76 aa) CDS CDS
ENSMUSE00001082972 PDZ (29/76 aa) CDS CDS
ENSMUSE00001062627 SH3_2 (2/61 aa) CDS Deleted
ENSMUSE00001069241 SH3_2 (60/61 aa) | SH3_domain (57/57 aa) CDS CDS + stop codon + UTR
ENSMUSE00001066506 SH3_2 (1/61 aa) CDS
ENSMUSE00000633671 CDS
ENSMUSE00001082850 CDS
ENSMUSE00001050241 CDS
ENSMUSE00000995213 Guanylate_kin (31/177 aa) CDS
ENSMUSE00001085367 Guanylate_kin (58/177 aa) CDS
ENSMUSE00001016750 Guanylate_kin (37/177 aa) CDS
ENSMUSE00000993832 Guanylate_kin (32/177 aa) CDS
ENSMUSE00000464440 Guanylate_kin (22/177 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000138389 processed_transcript No analysis available: incomplete transcript
ENSMUST00000152139 retained_intron Target region does not overlap transcript
ENSMUST00000129818 retained_intron No analysis available: incomplete transcript
ENSMUST00000146563 processed_transcript No analysis available: incomplete transcript
ENSMUST00000135581 processed_transcript No analysis available: incomplete transcript
ENSMUST00000128592 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0635_5_E12 PG00068_Z_3_F03 Dlg2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0635_5_D10 PG00068_Z_3_F03 Dlg2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0635_5_B11 PG00068_Z_3_F03 Dlg2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0735_4_C06 PG00068_Z_6_H05 Dlg2tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0735_4_D08 PG00068_Z_6_H05 Dlg2tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order HEPD0735_4_H05 PG00068_Z_6_H05 Dlg2tm1e(EUCOMM)Hmgu Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PATHP0001_A_1_A02 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00068_Z_1_H05 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00068_Z_3_H05 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PATHP0002_A_1_A03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00068_A_H05 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00068_Z_5_H05 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00068_Z_3_F03 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00068_Z_6_H05 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00068_Z_7_H05 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 42053 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00068_Z_1_H05 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
42053 Knockout First, Reporter-tagged insertion with conditional potential PCS00068_A_H05