IKMC Project Report - EUCOMM (ID: 27902)

Wnt4 MGI:98957 ENSMUSG00000036856 OTTMUSG00000009828
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000045747 protein_coding No protein product (NMD) view

Predicted translation: 

MSPRSCLRSLRLLVFAVFSAAASNWLDPGGGLCIRHLFSRCGLCSDKGMQQWRTGEVWL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000597028 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000259250 Wnt (62/309 aa) CDS Deleted
ENSMUSE00000259241 Wnt (45/309 aa) CDS CDS + stop codon + UTR
ENSMUSE00000259229 Wnt (48/309 aa) CDS
ENSMUSE00000336923 Wnt (155/309 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 535 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PGR00001_A_2_D01 L1L2_Bact_P R3R4_pBR_amp view
order 535 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PGR00001_A_1_D01 L1L2_Bact_P R3R4_pBR_amp view
order 535 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PGR00001_A_4_D01 L1L2_Bact_P R3R4_pBR_amp view
order 535 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PGR00001_A_3_D01 L1L2_Bact_P R3R4_pBR_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
535 Knockout First, Reporter-tagged insertion with conditional potential PCS00016_A_H05