IKMC Project Report - EUCOMM (ID: 28396)

Arvcf MGI:109620 ENSMUSG00000000325 OTTMUSG00000026041
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Genotype confirmed

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Arvcftm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) EPD0102_1_D06 C57BL/6NTac;C57BL/6NTac;C57BL/6N view
( about ) 		HMGU
Southern Blot pass TV Backbone Assay na 5' LR-PCR pass
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR na 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR na LoxP Confirmation fail 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000115613 protein_coding No protein product (NMD) view

Predicted translation: 

MEDCNVHSAASILASVKEQEARFERLTRALEQERRHVALQLERAQQPGMSSGGMVGSGQPLPMAWQQLVLQAHSGTCHPT
SP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000645181 UTR UTR
ENSMUSE00000645179 UTR UTR
ENSMUSE00000703585 UTR UTR
ENSMUSE00000395708 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000129825 CDS Deleted
ENSMUSE00000339372 Armadillo (36/36 aa) | Armadillo (33/41 aa) CDS Deleted
ENSMUSE00000129827 Armadillo (9/41 aa) CDS CDS + stop codon + UTR
ENSMUSE00000992852 CDS
ENSMUSE00000129836 CDS
ENSMUSE00001003693 CDS
ENSMUSE00001080895 CDS
ENSMUSE00001094502 Armadillo (35/35 aa) CDS
ENSMUSE00001079749 CDS
ENSMUSE00000978587 CDS
ENSMUSE00001085377 CDS
ENSMUSE00001076066 CDS
ENSMUSE00001009699 CDS
ENSMUSE00001001403 CDS
ENSMUSE00001091749 CDS + stop codon + UTR
ENSMUSE00000561967 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000090103 protein_coding No protein product (NMD) view

Predicted translation: 

MEDCNVHSAASILASVKEQEARFERLTRALEQERRHVALQLERAQQPGMSSGGMVGSGQPLPMAWQQLVLQAHSGTCHPT
SP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000645181 UTR UTR
ENSMUSE00000645179 UTR UTR
ENSMUSE00000395708 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000129825 CDS Deleted
ENSMUSE00000339372 Armadillo (36/36 aa) | Armadillo (33/41 aa) CDS Deleted
ENSMUSE00000129827 Armadillo (9/41 aa) CDS CDS + stop codon + UTR
ENSMUSE00000992852 CDS
ENSMUSE00000129836 CDS
ENSMUSE00001003693 CDS
ENSMUSE00001080895 CDS
ENSMUSE00001094502 Armadillo (35/35 aa) CDS
ENSMUSE00001079749 CDS
ENSMUSE00000978587 CDS
ENSMUSE00001085377 CDS
ENSMUSE00001076066 CDS
ENSMUSE00001009699 CDS
ENSMUSE00001001403 CDS
ENSMUSE00001091749 CDS + stop codon + UTR
ENSMUSE00001070310 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000115614 protein_coding No protein product (NMD) view

Predicted translation: 

MEDCNVHSAASILASVKEQEARFERLTRALEQERRHVALQLERAQQPGMSSGGMVGSGQPLPMAWQQLVLQAHSGTCHPT
SP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000761208 UTR UTR
ENSMUSE00000645179 UTR UTR
ENSMUSE00000395708 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000129825 CDS Deleted
ENSMUSE00000339372 Armadillo (36/36 aa) | Armadillo (33/41 aa) CDS Deleted
ENSMUSE00000129827 Armadillo (9/41 aa) CDS CDS + stop codon + UTR
ENSMUSE00000992852 CDS
ENSMUSE00000129836 CDS
ENSMUSE00001080895 CDS
ENSMUSE00001094502 Armadillo (35/35 aa) CDS
ENSMUSE00001079749 CDS
ENSMUSE00000978587 CDS
ENSMUSE00001085377 CDS
ENSMUSE00001076066 CDS
ENSMUSE00001009699 CDS
ENSMUSE00001001403 CDS
ENSMUSE00001091749 CDS + stop codon + UTR
ENSMUSE00000561967 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000115612 protein_coding No analysis available: incomplete transcript
ENSMUST00000115610 protein_coding Residual C-terminal product view

Predicted translation: 

MVIIDHGLQTLTHEVIVPHSGWEREPNEDSKPRDAEWTTVFKNTSGCLRNVSSDGAEARRRLRECEGLVDALLHALQSAV
GRKDTDNKSVENCVCIMRNLSYHVHKEVPGADRYQEAEPGIPGSTTSQRRRKDDASCFGGKKAKGKKDAEMDRNFDTLDL
PKRTEAAKGFELLYQPEVVRLYLSLLTESRNFNTLEAAAGALQNLSAGNWTWATYIRATVRKERGLPVLVELLQSETDKV
VRAVAIALRNLSLDQRNKDLIGSYAMTELVRNVRNAQAPAHPSAHLEEDTVVAVLNTIHEIVSDSLDNARSLLQARGVPA
LVALVASSQSVREAKAASHVLQTVWSYKELRGALQRDGWTKSRFQSASTAKGPKGTPSSGGFDDSTLPLVDKSLDGEKSN
TRDVIPMDTLGPDGYATVDRRERRTLGSDSTGDTSEKELLRPDPGRKAPPPGPSRPSVRLVDAVGDTKPQPVDSWV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000703577 UTR + start codon + CDS
ENSMUSE00000129825 CDS Deleted
ENSMUSE00000339372 Armadillo (36/36 aa) | Armadillo (33/41 aa) CDS Deleted
ENSMUSE00000129827 Armadillo (9/41 aa) CDS UTR + start codon + CDS
ENSMUSE00000992852 CDS CDS
ENSMUSE00000129836 CDS CDS
ENSMUSE00001080895 CDS CDS
ENSMUSE00001094502 Armadillo (35/35 aa) CDS CDS
ENSMUSE00001079749 CDS CDS
ENSMUSE00000978587 CDS CDS
ENSMUSE00001085377 CDS CDS
ENSMUSE00001076066 CDS CDS
ENSMUSE00001009699 CDS CDS
ENSMUSE00001001403 CDS CDS
ENSMUSE00000703576 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000150253 nonsense_mediated_decay Residual C-terminal product view

Predicted translation: 

MTPAALVARKQKGRRMQRWTGTLTHWTCLNERRLQKASSCCTSRRWYVSTSHSLRRAGTSTPWKLQPVPCKTSVLATGRG
PRTSVPQCARNVGCQYWWNCYSLRPTRWCAL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001080656 UTR + start codon + CDS
ENSMUSE00000805987 CDS Deleted
ENSMUSE00000731280 CDS UTR + start codon + CDS
ENSMUSE00001080178 CDS CDS
ENSMUSE00000999702 CDS CDS
ENSMUSE00001088099 CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00001081282 UTR UTR
ENSMUSE00000969721 UTR UTR
ENSMUSE00000989224 UTR UTR
ENSMUSE00001036079 UTR UTR
ENSMUSE00001051100 UTR UTR
ENSMUSE00000969214 UTR UTR
ENSMUSE00000561967 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000152132 retained_intron Target region does not overlap transcript
ENSMUST00000126183 retained_intron Target region does not overlap transcript
ENSMUST00000155548 processed_transcript No analysis available: incomplete transcript
ENSMUST00000150484 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0102_1_D06 PGS00050_A_B05 Arvcftm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view yes view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_A04 PGS00050_A_B05 Arvcftm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_B04 PGS00050_A_B05 Arvcftm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_B05 PGS00050_A_B05 Arvcftm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_E04 PGS00050_A_B05 Arvcftm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_E06 PGS00050_A_B05 Arvcftm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_F04 PGS00050_A_B05 Arvcftm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_F05 PGS00050_A_B05 Arvcftm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_G05 PGS00050_A_B05 Arvcftm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0102_1_A05 PGS00050_A_B05 Arvcftm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_C04 PGS00050_A_B05 Arvcftm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_C05 PGS00050_A_B05 Arvcftm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_C06 PGS00050_A_B05 Arvcftm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_D04 PGS00050_A_B05 Arvcftm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_E05 PGS00050_A_B05 Arvcftm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0102_1_G04 PGS00050_A_B05 Arvcftm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 44477 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00050_A_6_B05 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44477 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00050_A_5_B05 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44477 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00050_A_1_B05 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44477 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00050_A_8_B05 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44477 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00050_A_4_B05 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44477 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00050_A_2_B05 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44477 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00050_A_3_B05 L1L2_gt0 L3L4_pZero_DTA_kan view
order 44477 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00050_A_B05 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
44477 Knockout First, Reporter-tagged insertion with conditional potential PCS00050_A_B05