IKMC Project Report - (ID: 28436)

non-BioMart die(): Cannot write to '/nfs/team87/services/biomart/ikmc-mart/production/server/releases/20110531105342/logs/log4perl_log': No space left on device at /software/team87/brave_new_world/lib/perl5/Log/Log4perl/Appender/File.pm line 245.
Pre-pipeline Designs Vectors ES Cells Mice

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000063719 protein_coding No protein product (NMD) view

Predicted translation:

MKLLCLVAVVGCLLVPPAQANKSSEDIRCKCICPPYRNISGHIYNQNVSQKDWSLLSSTCLWWGPSYSTWPS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000332601 UTR UTR
ENSMUSE00000237854 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000443553 TMEM9 (18/148 aa) CDS CDS
ENSMUSE00000237833 TMEM9 (37/148 aa) CDS Deleted
ENSMUSE00000158800 TMEM9 (44/148 aa) CDS CDS + stop codon + UTR
ENSMUSE00000500416 TMEM9 (50/148 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000117950 protein_coding No protein product (NMD) view

Predicted translation:

MKLLCLVAVVGCLLVPPAQANKSSEDIRCKCICPPYRNISGHIYNQNVSQKDWSLLSSTCLWWGPSYSTWPS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000717717 UTR UTR
ENSMUSE00000237854 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000443553 TMEM9 (18/148 aa) CDS CDS
ENSMUSE00000237833 TMEM9 (37/148 aa) CDS Deleted
ENSMUSE00000158800 TMEM9 (44/148 aa) CDS CDS + stop codon + UTR
ENSMUSE00000720918 TMEM9 (50/148 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000165125 protein_coding No protein product (NMD) view

Predicted translation:

MKLLCLVAVVGCLLVPPAQANKSSEDIRCKCICPPYRNISGHIYNQNVSQKDWSLLSSTCLWWGPSYSTWPS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000913145 UTR UTR
ENSMUSE00000237854 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000443553 TMEM9 (18/148 aa) CDS CDS
ENSMUSE00000237833 TMEM9 (37/148 aa) CDS Deleted
ENSMUSE00000158800 TMEM9 (44/148 aa) CDS CDS + stop codon + UTR
ENSMUSE00000897579 TMEM9 (50/148 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000118832 protein_coding No protein product (NMD) view

Predicted translation:

MKLLCLVAVVGCLLVPPAQANKSSEDIRCKCICPPYRNISGHIYNQNVSQKDWSLLSSTCLWWGPSYSTWPS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000721730 UTR UTR
ENSMUSE00000237854 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000443553 TMEM9 (18/148 aa) CDS CDS
ENSMUSE00000237833 TMEM9 (37/148 aa) CDS Deleted
ENSMUSE00000158800 TMEM9 (44/148 aa) CDS CDS + stop codon + UTR
ENSMUSE00000710794 TMEM9 (50/148 aa) CDS + stop codon + UTR
ENSMUSE00000719122 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000140545 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available