IKMC Project Report - KOMP-CSD (ID: 28476)
Arhgap25 MGI:2443687 ENSMUSG00000030047 OTTMUSG00000023045
Mice
| Microinjection Status | Allele | Allele Type | ES Cell Clone | Genetic Background | QC Data | MI/Distribution Centre | ||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| currently unavailable | Genotype confirmed | Arhgap25tm2a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) | EPD0043_2_G05 | C57BL/6N |
view
( about ) |
UCD | |||||||||||||||||||||||||||||||
|
||||||||||||||||||||||||||||||||||||||
Mutagenesis Predictions
This gene has 4 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000113637 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MSLKLPRNWDFNLKAEASKIARSRSVMTGEQMAAFHPPTTPNPLERPIKVGWLKKQRSIVKNWQQRYFVLRAQQLYYYKD EEDSKPQGCMYLPGSTVKEIATNPEEAGKFVFEVIPASSDQNRIGQDSYVLMASSQVEMEEWVKFLRRVAGTPSGAVFGQ RLDETVAYEQKFGPHLVPILVEKCAEFILEHGVSEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRLSRSW*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000101197 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MTGEQMAAFHPPTTPNPLERPIKVGWLKKQRSIVKNWQQRYFVLRAQQLYYYKDEEDSKPQGCMYLPGSTVKEIATNPEE AGKFVFEVIPASSDQNRIGQDSYVLMASSQVEMEEWVKFLRRVAGTPSGAVFGQRLDETVAYEQKFGPHLVPILVEKCAE FILEHGVSEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRLSRSW*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000071024 | protein_coding | No protein product (NMD) | view | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Predicted translation: MYLPGSTVKEIATNPEEAGKFVFEVIPASSDQNRIGQDSYVLMASSQVEMEEWVKFLRRVAGTPSGAVFGQRLDETVAYE QKFGPHLVPILVEKCAEFILEHGVSEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRLSRSW*
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ENSMUST00000145128 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | EPD0043_2_G05 | PGS00036_A_A09 | Arhgap25tm2a(KOMP)Wtsi | Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) | JM8.F6 | view | yes | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 41908 | Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) | PG00036_A_4_A09 | L1L2_gt2 | L3L4_pZero_DTA_kan | view |
| order | 41908 | Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) | PG00036_A_3_A09 | L1L2_gt2 | L3L4_pZero_DTA_kan | view |
| order | 41908 | Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) | PG00036_A_2_A09 | L1L2_gt2 | L3L4_pZero_DTA_kan | view |
| order | 41908 | Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) | PG00036_A_1_A09 | L1L2_gt2 | L3L4_pZero_DTA_kan | view |
| order | 41908 | Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) | PGS00036_A_A09 | L1L2_gt2 | L3L4_pZero_DTA_kan | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 41908 | Knockout First, Reporter-tagged insertion with conditional potential | PCS00036_A_A09 |