IKMC Project Report - KOMP-CSD (ID: 28598)

Cldn18 MGI:1929209 ENSMUSG00000032473 OTTMUSG00000028913
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000035048 protein_coding No protein product (NMD) view

Predicted translation:

MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGFTECRPYFTILGLPGTPLVQL
CSWAGLLEASP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000778739 PMP22/EMP/MP20/Claudin (66/188 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000219922 PMP22/EMP/MP20/Claudin (56/188 aa) CDS Deleted
ENSMUSE00000219924 PMP22/EMP/MP20/Claudin (43/188 aa) CDS Deleted
ENSMUSE00000219921 PMP22/EMP/MP20/Claudin (26/188 aa) CDS CDS + stop codon + UTR
ENSMUSE00000324921 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112882 protein_coding No protein product (NMD) view

Predicted translation:

MSVTACQGLGFVVSLIGFAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPGTPLVQL
CSWAGLLEASP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000693514 PMP22/EMP/MP20/Claudin (65/187 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000219922 PMP22/EMP/MP20/Claudin (56/187 aa) CDS Deleted
ENSMUSE00000219924 PMP22/EMP/MP20/Claudin (43/187 aa) CDS Deleted
ENSMUSE00000219921 PMP22/EMP/MP20/Claudin (26/187 aa) CDS CDS + stop codon + UTR
ENSMUSE00000776046 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000136429 protein_coding No protein product (NMD) view

Predicted translation:

MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGFTECRPYFTILGLPGTPLVQL
CSWAGLLEASP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000488794 PMP22/EMP/MP20/Claudin (66/188 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000219922 PMP22/EMP/MP20/Claudin (56/188 aa) CDS Deleted
ENSMUSE00000219924 PMP22/EMP/MP20/Claudin (43/188 aa) CDS Deleted
ENSMUSE00000736968 PMP22/EMP/MP20/Claudin (26/188 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00000817980 UTR UTR
Legend: in frame deleted frameshifted
ENSMUST00000131922 protein_coding No protein product (NMD) view

Predicted translation:

MSVTACQGLGFVVSLIGFAGIIAATCMDQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPGTPLVQL
CSWAGLLEASP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000693514 PMP22/EMP/MP20/Claudin (65/187 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000219922 PMP22/EMP/MP20/Claudin (56/187 aa) CDS Deleted
ENSMUSE00000219924 PMP22/EMP/MP20/Claudin (43/187 aa) CDS Deleted
ENSMUSE00000736968 PMP22/EMP/MP20/Claudin (26/187 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00000829341 UTR UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available