IKMC Project Report - EUCOMM (ID: 28804)

Faim MGI:1344387 ENSMUSG00000032463
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000112911 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MASGDDSPIFEDDERKRHYGRMVQWSENGDSGRVCR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000390647 UTR UTR
ENSMUSE00000916332 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000986737 FAIM (36/176 aa) CDS Deleted
ENSMUSE00000219854 FAIM (77/176 aa) CDS Deleted
ENSMUSE00000219853 FAIM (17/176 aa) CDS CDS
ENSMUSE00000229910 FAIM (47/176 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000035038 protein_coding Residual C-terminal product view

Predicted translation: 

MDVWCNGQKMETAGEFVDDGTETHFSVGNHGCYIKAVSSGKRKEGIIHTLIVDNREIPELTQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000390647 UTR UTR
ENSMUSE00000976748 FAIM (36/176 aa) UTR + start codon + CDS Deleted
ENSMUSE00000219854 FAIM (77/176 aa) CDS Deleted
ENSMUSE00000219853 FAIM (17/176 aa) CDS UTR + start codon + CDS
ENSMUSE00000229910 FAIM (47/176 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 115316 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00123_Y_5_G05 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 115316 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00123_Y_5_F12 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 115316 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00123_Y_5_E02 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 115316 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00123_Y_5_A03 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 115316 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00123_Y_5_G04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 115316 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00123_Y_5_F10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 115316 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00123_Y_5_C04 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 115316 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00123_Y_5_C01 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 115316 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00123_Y_5_H10 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
115316 Knockout-First - Reporter Tagged Insertion PCTS00123_A_E11