IKMC Project Report - EUCOMM (ID: 29063)

Rab40b MGI:2183451 ENSMUSG00000025170 OTTMUSG00000004681
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000106107 protein_coding No protein product (NMD) view

Predicted translation:

MMSSLGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGTPRGRGDFVPYSAHTPEVHRVWSWSMTLPTD
GPLMALIDGLRRLMSMPLGFLKSWWEIGCTWHSSDRCPLNRPRPTPSAWV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000749912 Small_GTPase (32/159 aa) | MIRO-like (32/113 aa) | Small_GTPase_ARF/SAR (33/113 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000976381 Small_GTPase (21/159 aa) | MIRO-like (21/113 aa) | Small_GTPase_ARF/SAR (21/113 aa) CDS Deleted
ENSMUSE00001065078 Small_GTPase (21/159 aa) | MIRO-like (21/113 aa) | Small_GTPase_ARF/SAR (21/113 aa) CDS CDS
ENSMUSE00001054496 Small_GTPase (26/159 aa) | MIRO-like (26/113 aa) | Small_GTPase_ARF/SAR (26/113 aa) CDS CDS
ENSMUSE00000148507 Small_GTPase (61/159 aa) | MIRO-like (15/113 aa) | Small_GTPase_ARF/SAR (14/113 aa) CDS CDS + stop codon + UTR
ENSMUSE00000725271 SOCS_C (35/35 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000149948 processed_transcript No analysis available: incomplete transcript
ENSMUST00000124639 processed_transcript No analysis available: incomplete transcript
ENSMUST00000135290 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available