IKMC Project Report - EUCOMM (ID: 29443)

2410131K14Rik MGI:1924042 ENSMUSG00000032840 OTTMUSG00000028968
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000049138 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MLNLAALLWRRLLRKRWVLALVFGLSLVYFLSSTFKQAMSARGRTCWRMAVATSASPAQSSTAVMGAWPMAAVKPTSTAS
PAACSPASNFSWSASSTGQLWPSRTSSWQLKTTSNCAWLNAGPPPRVCNTRTRTVTP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000344235 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000290475 UPF0454 (22/128 aa) CDS Deleted
ENSMUSE00000290467 UPF0454 (51/128 aa) CDS CDS
ENSMUSE00000290455 UPF0454 (38/128 aa) CDS CDS
ENSMUSE00000459574 UPF0454 (18/128 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0843_1_G05 PG00224_Z_1_F06 2410131K14Riktm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 278442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00224_Z_1_C06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00224_Z_1_G06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00224_Z_1_F05 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00224_Z_1_C10 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00224_Z_1_F07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00224_Z_1_F06 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 278442 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00224_Z_1_G03 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
278442 Knockout First, Reporter-tagged insertion with conditional potential PCS00224_A_A06