IKMC Project Report - EUCOMM (ID: 29551)
Vamp3 MGI:1321389 ENSMUSG00000028955 OTTMUSG00000010239
Mice no data available
Mutagenesis Predictions
This gene has 3 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.
| Ensembl transcript id | Ensembl Biotype | Floxed transcript description | Details | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| ENSMUST00000030797 | protein_coding | Residual C-terminal product | view | |||||||||||||||||||||||||||||||
|
Predicted translation: MRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS*
|
||||||||||||||||||||||||||||||||||
| ENSMUST00000155446 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||
| ENSMUST00000125205 | retained_intron | No analysis available: incomplete transcript | ||||||||||||||||||||||||||||||||
ES Cell Clones With Conditional Potential
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0532_1_D08 | PRPGS00062_A_A04 | Vamp3tm1a(EUCOMM)Hmgu | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8.N4 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0911_2_H10 | PG00062_Z_3_A04 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
ES Cell Clones Without Conditional Potential
Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | Southern Blot Tool - LRPCR Genotyping Primers |
| ES Cell Clone | Targeting Vector | Allele | Allele Type | Parental ES Cell Line | Genbank File | Mouse | QC Data | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| order | HEPD0532_1_F05 | PRPGS00062_A_A04 | Vamp3tm1e(EUCOMM)Hmgu | Targeted Non-Conditional (Promotor Driven Cassette) | JM8.N4 | view | no | view ( about ) | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| order | EPD0911_2_B09 | PG00062_Z_3_A04 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | JM8A3.N1 | view | no | view ( about ) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Targeting Vectors
| Genome Browsers: | Ensembl (mouse) - UCSC (mouse) |
|---|---|
| Tools: | LRPCR Genotyping Primers |
| Design ID | Vector Type | Targeting Vector | Cassette | Backbone | Genbank File | |
|---|---|---|---|---|---|---|
| order | 46327 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PRPGS00062_A_A04 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 46327 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00062_Z_3_A04 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 46327 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00062_Z_1_A04 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 46327 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00062_Z_4_A04 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
| order | 46327 | Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) | PG00062_Z_2_A04 | L1L2_Bact_P | L3L4_pD223_DTA_T_spec | view |
Intermediate Vectors
| Design ID | Vector Type | Intermediate Vector |
|---|---|---|
| 46327 | Knockout-First - Reporter Tagged Insertion | PCS00062_B_A04 |
| 46327 | Knockout-First - Reporter Tagged Insertion | PCS00062_A_A04 |