IKMC Project Report - EUCOMM (ID: 29645)

Lactb2 MGI:2442551 ENSMUSG00000025937 OTTMUSG00000021599
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000027071 protein_coding No protein product (NMD) view

Predicted translation: 

MAAALQRIEQLSSRVVRVLGCNPGPMTLQGTNTYLVGTGSRRILIDTGEPSVPEYISCLKQALVEFDTAIQEILVTHWHS
DHSGGIVDICKNINNEFCTLLATLMITWLYSWRRRMPSFLGTAS*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000154319 Beta-lactamas-like (12/171 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000154323 Beta-lactamas-like (56/171 aa) CDS CDS
ENSMUSE00000154321 Beta-lactamas-like (43/171 aa) CDS Deleted
ENSMUSE00000316001 Beta-lactamas-like (61/171 aa) CDS CDS + stop codon + UTR
ENSMUSE00000154320 Beta-lactamas-like (3/171 aa) CDS
ENSMUSE00000154322 CDS
ENSMUSE00000378666 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000156222 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 49764 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00073_A_F07 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49764 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00073_Z_5_F07 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
49764 Knockout First, Reporter-tagged insertion with conditional potential PCS00073_A_F07