IKMC Project Report - KOMP-CSD (ID: 29843)

BC030499 MGI:2652869 ENSMUSG00000037593 OTTMUSG00000000104
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 6 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000046361 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MGAVSCRQGQHTRVSAPQKCVATAAWISTPCGLLLVGFQRILSVSLQLNWSLYCAISTTWVSSTVM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000287520 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001027742 CDS Deleted
ENSMUSE00000982671 Prot_kinase_cat_dom (28/163 aa) | Ser-Thr/Tyr_kinase_cat_dom (24/145 aa) CDS Deleted
ENSMUSE00001040775 Prot_kinase_cat_dom (23/163 aa) | Ser-Thr/Tyr_kinase_cat_dom (23/145 aa) CDS Deleted
ENSMUSE00001014067 Prot_kinase_cat_dom (24/163 aa) | Ser-Thr/Tyr_kinase_cat_dom (24/145 aa) CDS Deleted
ENSMUSE00001019239 Prot_kinase_cat_dom (36/163 aa) | Ser-Thr/Tyr_kinase_cat_dom (36/145 aa) CDS CDS
ENSMUSE00000287454 Prot_kinase_cat_dom (14/163 aa) | Ser-Thr/Tyr_kinase_cat_dom (14/145 aa) CDS CDS + stop codon + UTR
ENSMUSE00000287447 Prot_kinase_cat_dom (10/163 aa) | Ser-Thr/Tyr_kinase_cat_dom (10/145 aa) CDS
ENSMUSE00000578272 Prot_kinase_cat_dom (31/163 aa) | Ser-Thr/Tyr_kinase_cat_dom (17/145 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000136011 retained_intron Target region does not overlap transcript
ENSMUST00000147549 retained_intron No analysis available: incomplete transcript
ENSMUST00000122937 retained_intron No analysis available: incomplete transcript
ENSMUST00000124730 retained_intron No analysis available: incomplete transcript
ENSMUST00000130947 retained_intron No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available