IKMC Project Report - EUCOMM (ID: 30144)

Vdac2 MGI:106915 ENSMUSG00000021771 OTTMUSG00000016381
Pre-pipeline Designs Vectors ES Cells Mice
Vector Unsuccessful - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000022293 protein_coding No protein product (NMD) view

Predicted translation:

MAECCVPVCPRPMCIPPPYADLGKAARDIFNKGFGIFNIWLI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000786433 UTR UTR
ENSMUSE00000120729 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001089611 Porin_Euk (19/273 aa) CDS CDS
ENSMUSE00000120727 Porin_Euk (17/273 aa) CDS Deleted
ENSMUSE00001007055 Porin_Euk (51/273 aa) CDS CDS + stop codon + UTR
ENSMUSE00001010464 Porin_Euk (18/273 aa) CDS
ENSMUSE00001043221 Porin_Euk (77/273 aa) CDS
ENSMUSE00000120724 Porin_Euk (51/273 aa) CDS
ENSMUSE00000482094 Porin_Euk (20/273 aa) CDS
ENSMUSE00000775631 Porin_Euk (24/273 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000172727 protein_coding Residual C-terminal product view

Predicted translation:

MLTSAKLPETFSTKDLEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTF
SPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTN
VNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALV
DGKSFNAGGHKLGLALELEA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000928990 Porin_Euk (19/273 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000120727 Porin_Euk (17/273 aa) CDS Deleted
ENSMUSE00001007055 Porin_Euk (51/273 aa) CDS CDS
ENSMUSE00001010464 Porin_Euk (18/273 aa) CDS CDS
ENSMUSE00001043221 Porin_Euk (77/273 aa) CDS CDS
ENSMUSE00000120724 Porin_Euk (51/273 aa) CDS CDS
ENSMUSE00000482094 Porin_Euk (20/273 aa) CDS CDS
ENSMUSE00000931900 Porin_Euk (24/273 aa) CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
ENSMUST00000173456 protein_coding Residual C-terminal product view

Predicted translation:

MLTSAKLPETFSTKDLEFSTSGSSNTDTGKVSGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTF
SPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRSNFAVGYRTGDFQLHTN
VNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALV
DGKSFNAGGHKLGLALELEA*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000931821 UTR UTR
ENSMUSE00001092001 Porin_Euk (19/273 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000120727 Porin_Euk (17/273 aa) CDS Deleted
ENSMUSE00001007055 Porin_Euk (51/273 aa) CDS CDS
ENSMUSE00001010464 Porin_Euk (18/273 aa) CDS CDS
ENSMUSE00001043221 Porin_Euk (77/273 aa) CDS CDS
ENSMUSE00000120724 Porin_Euk (51/273 aa) CDS CDS
ENSMUSE00000482094 Porin_Euk (20/273 aa) CDS CDS
ENSMUSE00000931900 Porin_Euk (24/273 aa) CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
ENSMUST00000153320 protein_coding No analysis available: incomplete transcript
ENSMUST00000152562 protein_coding No analysis available: incomplete transcript
ENSMUST00000142084 retained_intron Target region does not overlap transcript
ENSMUST00000132364 retained_intron Target region does not overlap transcript
ENSMUST00000130224 retained_intron Target region does not overlap transcript
ENSMUST00000147715 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available