IKMC Project Report - EUCOMM (ID: 30398)

Asns MGI:1350929 ENSMUSG00000029752 OTTMUSG00000022779
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) EPD0525_1_F01 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		Harwell
Southern Blot pass TV Backbone Assay na 5' LR-PCR na
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) na
LacZ SR-PCR na 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR na LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 5 are protein-coding. Following removal of the floxed region, 5 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000031766 protein_coding No protein product (NMD) view

Predicted translation: 

MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYN
HKAALFP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000414501 UTR UTR
ENSMUSE00000192224 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000192225 GATase_2 (52/52 aa) CDS Deleted
ENSMUSE00000192221 CDS CDS + stop codon + UTR
ENSMUSE00000192226 Asn_synthase (24/233 aa) CDS
ENSMUSE00000192220 Asn_synthase (43/233 aa) CDS
ENSMUSE00000192227 Asn_synthase (43/233 aa) CDS
ENSMUSE00000192228 Asn_synthase (36/233 aa) CDS
ENSMUSE00000192223 Asn_synthase (34/233 aa) CDS
ENSMUSE00001015625 Asn_synthase (28/233 aa) CDS
ENSMUSE00001010073 Asn_synthase (28/233 aa) CDS
ENSMUSE00000703338 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000115542 protein_coding No protein product (NMD) view

Predicted translation: 

MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVRKYPYLWLCYNGEIYN
HKAALFP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000703339 UTR UTR
ENSMUSE00000192224 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000192225 GATase_2 (52/52 aa) CDS Deleted
ENSMUSE00000192221 CDS CDS + stop codon + UTR
ENSMUSE00000192226 Asn_synthase (24/233 aa) CDS
ENSMUSE00000192220 Asn_synthase (43/233 aa) CDS
ENSMUSE00000192227 Asn_synthase (43/233 aa) CDS
ENSMUSE00000192228 Asn_synthase (36/233 aa) CDS
ENSMUSE00000192223 Asn_synthase (34/233 aa) CDS
ENSMUSE00001015625 Asn_synthase (28/233 aa) CDS
ENSMUSE00001010073 Asn_synthase (28/233 aa) CDS
ENSMUSE00000703338 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000126303 protein_coding No analysis available: incomplete transcript
ENSMUST00000139596 protein_coding No analysis available: incomplete transcript
ENSMUST00000148349 protein_coding No analysis available: incomplete transcript
ENSMUST00000133972 retained_intron Target region does not overlap transcript
ENSMUST00000140097 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0525_1_F01 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot pass Map Test - Karyotype pass
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation pass
3' LR-PCR -
order EPD0525_1_A02 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_A03 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_A04 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_B01 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_B02 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_B03 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_C01 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_C02 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_C03 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_D01 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_D02 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_D03 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_E01 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_E02 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_E03 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_E04 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_F02 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_F03 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_G01 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_G02 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_G03 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_G04 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_H01 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_H02 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_H03 PG00032_A_3_B03 Asnstm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0525_1_B04 PG00032_A_3_B03 Asnstm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_C04 PG00032_A_3_B03 Asnstm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_D04 PG00032_A_3_B03 Asnstm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 41587 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00032_A_1_B03 L1L2_gt0 L3L4_pZero_DTA_kan view
order 41587 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00032_A_2_B03 L1L2_gt0 L3L4_pZero_DTA_kan view
order 41587 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00032_A_4_B03 L1L2_gt0 L3L4_pZero_DTA_kan view
order 41587 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00032_A_B03 L1L2_gt0 L3L4_pZero_DTA_kan view
order 41587 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00032_A_3_B03 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
41587 Knockout First, Reporter-tagged insertion with conditional potential PCS00032_A_B03