IKMC Project Report - KOMP-CSD (ID: 30437)

1110057K04Rik MGI:1916082 ENSMUSG00000037669
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete - Project Terminated

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000037383 protein_coding No protein product (NMD) view

Predicted translation:

MASEVEEQIPVREEFFLCGGVETKIIKCGPWTNLFEKQDVSKPKQLIFIIPGNPGYSAFYVPFAKALYTLMKSRFPVWII
SHAGFSVTPKDKKVLAAPQGRPRLSALPNYRTNV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000396424 UTR UTR
ENSMUSE00001007291 DUF2305 (8/261 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001029152 DUF2305 (49/261 aa) CDS CDS
ENSMUSE00001082801 DUF2305 (58/261 aa) CDS Deleted
ENSMUSE00000964415 DUF2305 (79/261 aa) CDS CDS + stop codon + UTR
ENSMUSE00000237621 DUF2305 (28/261 aa) CDS
ENSMUSE00000995724 DUF2305 (42/261 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000169104 protein_coding No protein product (NMD) view

Predicted translation:

MASEVEEQIPVREEFFLCGGVETKIIKCGPWTNLFEKQDVSKPKQLIFIIPGNPGYSAFYVPFAKALYTLMKSRFPVWII
SHAGFSVTPKDKKVLAAPQGRPRLSALPNYRTNV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000892493 UTR UTR
ENSMUSE00001007291 DUF2305 (8/192 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001029152 DUF2305 (49/192 aa) CDS CDS
ENSMUSE00001082801 DUF2305 (58/192 aa) CDS Deleted
ENSMUSE00000964415 DUF2305 (79/192 aa) CDS CDS + stop codon + UTR
ENSMUSE00001054882 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones With Conditional Potential

ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0564_4_B03 PRPGS00164_A_D11 1110057K04Riktm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0564_4_F01 PRPGS00164_A_D11 1110057K04Riktm1a(EUCOMM)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 221339 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00164_Z_4_D11 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221339 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00164_Z_1_D11 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221339 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00164_Z_5_D11 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
order 221339 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00164_A_D11 L1L2_Bact_P R3R4_pBR_DTA+_Bsd_amp view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
221339 Knockout-First - Reporter Tagged Insertion PCS00164_A_D11