IKMC Project Report - KOMP-CSD (ID: 30701)

Wars2 MGI:1917810 ENSMUSG00000004233 OTTMUSG00000006862
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 4 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000004343 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation:

MALFSVRKARECWRFIRALHKGPAATLAPQKESGERVFSGIQPTGILHLGNYLGAIESWVNLQEEYDTVIYSIVDLHSIT
VPQDPTVLQQSILDMTAVLLACGINPEKSILFQQSKVHTRSCRGGSSPAHGTSSGSSSKFQPKVWGVLSIAQVHSHIHEE
SEISSRPFFQDVKIGP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000745850 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000979786 aa-tRNA-synth_Ic (81/259 aa) CDS CDS
ENSMUSE00001039760 aa-tRNA-synth_Ic (27/259 aa) CDS Deleted
ENSMUSE00001090702 aa-tRNA-synth_Ic (29/259 aa) CDS Deleted
ENSMUSE00001033410 aa-tRNA-synth_Ic (41/259 aa) CDS CDS
ENSMUSE00000173769 aa-tRNA-synth_Ic (83/259 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000135960 processed_transcript No analysis available: incomplete transcript
ENSMUST00000145650 processed_transcript No analysis available: incomplete transcript
ENSMUST00000126875 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available