IKMC Project Report - KOMP-CSD (ID: 30806)

Myo16 MGI:2685951 ENSMUSG00000039057
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000042103 protein_coding No protein product (NMD) view

Predicted translation: 

MEIDQCLLESLPLGQRQRLVKRMRCEQIKAYYEREKVFQKQEGPLKRSKPGKRQKVRFGLADMIQDAVIHHHDKEVLQLL
KEGADPHTLVSSGGSLLHLCARYDNVFIAEVLIDRGVNVNHQDEDFWTPMHIACACDNPDIVLLLILAGANVFLQDVNGN
IPLDYAVEGTESSAILLAYLDEKGVDLSSLRQIKLQRPLSMLTDVRHFLSSGGDVNEKNDDGVTLLHMACASGYKEVVLL
LLEHGGDLNGTDDRYWTPLHLAAKYGQTTLVKLLLAHQANPHLVNCNGEKPSDIAASESIEEMLLKAEIAWEEKMKESPS
APSLAQEELYEILHDLPDLSSKLSPLVLPIAKQDSLLEKDIMFKDTTKGLCKQESQDGPPETSMTSNCGKPEQVQVMPPA
PSDDLATLSELNDSSLLYEIQKRFGNDQIHWRTRVREDPGQQADHEVPDQQGQLQLYHV*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000638268 CDS CDS
ENSMUSE00000638267 CDS CDS
ENSMUSE00000638266 Ankyrin_rpt (20/30 aa) CDS CDS
ENSMUSE00000638265 Ankyrin_rpt (10/30 aa) CDS CDS
ENSMUSE00000638263 Ankyrin_rpt (4/33 aa) CDS CDS
ENSMUSE00000638261 Ankyrin_rpt (29/33 aa) | Ankyrin_rpt (11/30 aa) CDS CDS
ENSMUSE00000638260 Ankyrin_rpt (19/30 aa) CDS CDS
ENSMUSE00000638258 CDS CDS
ENSMUSE00000638256 CDS CDS
ENSMUSE00000638255 Myosin_head_motor_dom (27/729 aa) CDS CDS
ENSMUSE00000638254 Myosin_head_motor_dom (22/729 aa) CDS Deleted
ENSMUSE00000638253 Myosin_head_motor_dom (43/729 aa) CDS Deleted
ENSMUSE00000638252 Myosin_head_motor_dom (36/729 aa) CDS CDS + stop codon + UTR
ENSMUSE00000638251 Myosin_head_motor_dom (40/729 aa) CDS
ENSMUSE00000638250 Myosin_head_motor_dom (50/729 aa) CDS
ENSMUSE00000638249 Myosin_head_motor_dom (38/729 aa) CDS
ENSMUSE00000638248 Myosin_head_motor_dom (40/729 aa) CDS
ENSMUSE00000638247 Myosin_head_motor_dom (25/729 aa) CDS
ENSMUSE00000283226 Myosin_head_motor_dom (48/729 aa) CDS
ENSMUSE00000283215 Myosin_head_motor_dom (25/729 aa) CDS
ENSMUSE00000283208 Myosin_head_motor_dom (51/729 aa) CDS
ENSMUSE00000283199 Myosin_head_motor_dom (67/729 aa) CDS
ENSMUSE00000283190 Myosin_head_motor_dom (26/729 aa) CDS
ENSMUSE00000523508 Myosin_head_motor_dom (58/729 aa) CDS
ENSMUSE00000523507 Myosin_head_motor_dom (27/729 aa) CDS
ENSMUSE00000523506 Myosin_head_motor_dom (69/729 aa) CDS
ENSMUSE00000523505 Myosin_head_motor_dom (35/729 aa) CDS
ENSMUSE00000523504 Myosin_head_motor_dom (10/729 aa) CDS
ENSMUSE00000523503 CDS
ENSMUSE00000518233 CDS
ENSMUSE00000523500 CDS
ENSMUSE00000686024 CDS
ENSMUSE00000978166 CDS
ENSMUSE00001043591 CDS
ENSMUSE00001001946 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0671_1_B07 PG00089_Y_2_A01 Myo16tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0671_1_A07 PG00089_Y_2_A01 Myo16tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0671_1_D06 PG00089_Y_2_A01 Myo16tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0671_1_H07 PG00089_Y_2_A01 Myo16tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0671_1_F06 PG00089_Y_2_A01 Myo16tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0932_4_C05 PG00089_Y_1_A02 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 88287 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00089_Y_4_A04 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 88287 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00089_Y_3_A01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 88287 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00089_A_A02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 88287 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00089_Y_2_A01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 88287 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00089_Y_1_A02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 88287 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00089_Y_4_A02 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
order 88287 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00089_Y_4_A01 L1L2_Bact_P L3L4_pD223_DTA_T_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
88287 Knockout First, Reporter-tagged insertion with conditional potential PCS00089_A_A02
88287 Knockout First, Reporter-tagged insertion with conditional potential PCS00089_B_A02