IKMC Project Report - EUCOMM (ID: 31455)

G2e3 MGI:2444298 ENSMUSG00000035293 OTTMUSG00000031423
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 5 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 3 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000119211 protein_coding No protein product (NMD) view

Predicted translation:

MNENKPDNSQSLACVFCRKNDDCPNKYGEKKTYEKWNFSVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVQRASKLV
ILLETSTRSSNYI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000714288 UTR UTR
ENSMUSE00000312335 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000312327 CDS CDS
ENSMUSE00000312319 CDS CDS
ENSMUSE00000312313 CDS Deleted
ENSMUSE00000312307 CDS CDS + stop codon + UTR
ENSMUSE00000992467 CDS
ENSMUSE00001064279 CDS
ENSMUSE00000339985 CDS
ENSMUSE00000312271 CDS
ENSMUSE00000709478 CDS
ENSMUSE00000312263 HECT (8/261 aa) CDS
ENSMUSE00000312256 HECT (61/261 aa) CDS
ENSMUSE00000312249 HECT (58/261 aa) CDS
ENSMUSE00000312244 HECT (65/261 aa) CDS
ENSMUSE00000720549 HECT (72/261 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000054308 protein_coding No protein product (NMD) view

Predicted translation:

MNENKPDNSQSLACVFCRKNDDCPNKYGEKKTYEKWNFSVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVQRASKLV
ILLETSTRSSNYI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000489512 UTR UTR
ENSMUSE00000312335 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000312327 CDS CDS
ENSMUSE00000312319 CDS CDS
ENSMUSE00000312313 CDS Deleted
ENSMUSE00000312307 CDS CDS + stop codon + UTR
ENSMUSE00000992467 CDS
ENSMUSE00001064279 CDS
ENSMUSE00000339985 CDS
ENSMUSE00000312271 CDS
ENSMUSE00000312263 HECT (8/261 aa) CDS
ENSMUSE00000312256 HECT (61/261 aa) CDS
ENSMUSE00000312249 HECT (58/261 aa) CDS
ENSMUSE00000312244 HECT (65/261 aa) CDS
ENSMUSE00000390517 HECT (72/261 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000121521 protein_coding No protein product (NMD) view

Predicted translation:

MNENKPDNSQSLACVFCRKNDDCPNKYGEKKTYEKWNFSVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVQRASKLV
ILLETSTRSSNYI*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000713285 UTR UTR
ENSMUSE00000312335 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000312327 CDS CDS
ENSMUSE00000312319 CDS CDS
ENSMUSE00000312313 CDS Deleted
ENSMUSE00000312307 CDS CDS + stop codon + UTR
ENSMUSE00000992467 CDS
ENSMUSE00001064279 CDS
ENSMUSE00000339985 CDS
ENSMUSE00000312271 HECT (3/264 aa) CDS
ENSMUSE00000721442 HECT (69/264 aa) CDS
ENSMUSE00000312249 HECT (58/264 aa) CDS
ENSMUSE00000312244 HECT (65/264 aa) CDS
ENSMUSE00000716807 HECT (72/264 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000152236 retained_intron Target region does not overlap transcript
ENSMUST00000144767 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 55295 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00076_A_E05 L1L2_Bact_P L3L4_pD223_DTA_spec view

Intermediate Vectors

Design ID Vector Type Intermediate Vector
55295 Knockout-First - Reporter Tagged Insertion PCS00076_A_E05