IKMC Project Report - EUCOMM (ID: 31464)

Dync1i2 MGI:107750 ENSMUSG00000027012 OTTMUSG00000013157
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) EPD0525_1_B10 C57BL/6NTac;C57BL/6NTac;C57BL/6N-Atm1Brd/a view
( about ) 		WTSI/HMGU
Southern Blot na TV Backbone Assay pass 5' LR-PCR na
Loss of WT Allele (LOA) qPCR pass Homozygous Loss of WT Allele (LOA) SR-PCR na Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 12 wild type transcripts, of which 8 are protein-coding. Following removal of the floxed region, 8 transcripts are predicted to produce a truncated protein product of which 8 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000081710 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKESLLLCLHPPSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000803076 UTR UTR
ENSMUSE00001010945 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001049859 CDS Deleted
ENSMUSE00001075173 CDS CDS + stop codon + UTR
ENSMUSE00001029088 (33/33 aa) CDS
ENSMUSE00001026976 CDS
ENSMUSE00001043780 CDS
ENSMUSE00001034096 CDS
ENSMUSE00001030055 CDS
ENSMUSE00001058804 WD40_repeat (2/33 aa) CDS
ENSMUSE00000996201 WD40_repeat (31/33 aa) CDS
ENSMUSE00001046485 CDS
ENSMUSE00001088626 WD40_repeat (38/38 aa) CDS
ENSMUSE00000165467 CDS
ENSMUSE00000165441 CDS
ENSMUSE00000690592 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112140 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEFFLSTGSLLLCLHPPSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000690593 UTR UTR
ENSMUSE00001010945 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001049859 CDS Deleted
ENSMUSE00001026566 CDS CDS
ENSMUSE00001075173 CDS CDS + stop codon + UTR
ENSMUSE00000644580 CDS
ENSMUSE00001029088 (33/33 aa) CDS
ENSMUSE00001026976 CDS
ENSMUSE00001043780 CDS
ENSMUSE00001034096 CDS
ENSMUSE00001030055 CDS
ENSMUSE00001058804 WD40_repeat (2/33 aa) CDS
ENSMUSE00000996201 WD40_repeat (31/33 aa) CDS
ENSMUSE00001046485 CDS
ENSMUSE00001088626 WD40_repeat (38/38 aa) CDS
ENSMUSE00000165467 CDS
ENSMUSE00000165441 CDS
ENSMUSE00000690592 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112144 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEFFLSTGSLLLCLHPPSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000644581 UTR UTR
ENSMUSE00001010945 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001049859 CDS Deleted
ENSMUSE00001026566 CDS CDS
ENSMUSE00001075173 CDS CDS + stop codon + UTR
ENSMUSE00000644580 CDS
ENSMUSE00001029088 (33/33 aa) CDS
ENSMUSE00001026976 CDS
ENSMUSE00001043780 CDS
ENSMUSE00001034096 CDS
ENSMUSE00001030055 CDS
ENSMUSE00001058804 WD40_repeat (2/33 aa) CDS
ENSMUSE00000996201 WD40_repeat (31/33 aa) CDS
ENSMUSE00001046485 CDS
ENSMUSE00001088626 WD40_repeat (38/38 aa) CDS
ENSMUSE00000165467 CDS
ENSMUSE00000165441 CDS
ENSMUSE00000690598 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112136 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKEFFLSTGSLLLCLHPPSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000644574 UTR UTR
ENSMUSE00001010945 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001049859 CDS Deleted
ENSMUSE00001026566 CDS CDS
ENSMUSE00001075173 CDS CDS + stop codon + UTR
ENSMUSE00000644580 CDS
ENSMUSE00001029088 (33/33 aa) CDS
ENSMUSE00001026976 CDS
ENSMUSE00001043780 CDS
ENSMUSE00001034096 CDS
ENSMUSE00001030055 CDS
ENSMUSE00001058804 WD40_repeat (2/33 aa) CDS
ENSMUSE00000996201 WD40_repeat (31/33 aa) CDS
ENSMUSE00001046485 CDS
ENSMUSE00001088626 WD40_repeat (38/38 aa) CDS
ENSMUSE00000165467 CDS
ENSMUSE00000165441 CDS
ENSMUSE00000690579 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112142 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKESLLLCLHPPSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000690596 UTR UTR
ENSMUSE00001010945 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001049859 CDS Deleted
ENSMUSE00001075173 CDS CDS + stop codon + UTR
ENSMUSE00000644580 CDS
ENSMUSE00001029088 (33/33 aa) CDS
ENSMUSE00001026976 CDS
ENSMUSE00001043780 CDS
ENSMUSE00001034096 CDS
ENSMUSE00001030055 CDS
ENSMUSE00001058804 WD40_repeat (2/33 aa) CDS
ENSMUSE00000996201 WD40_repeat (31/33 aa) CDS
ENSMUSE00001046485 CDS
ENSMUSE00001088626 WD40_repeat (38/38 aa) CDS
ENSMUSE00000165467 CDS
ENSMUSE00000165441 CDS
ENSMUSE00000690595 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000100028 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKESLLLCLHPPSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000820934 UTR UTR
ENSMUSE00001010945 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001049859 CDS Deleted
ENSMUSE00001075173 CDS CDS + stop codon + UTR
ENSMUSE00000644580 CDS
ENSMUSE00001029088 (33/33 aa) CDS
ENSMUSE00001026976 CDS
ENSMUSE00001043780 CDS
ENSMUSE00001034096 CDS
ENSMUSE00001030055 CDS
ENSMUSE00001058804 WD40_repeat (2/33 aa) CDS
ENSMUSE00000996201 WD40_repeat (31/33 aa) CDS
ENSMUSE00001046485 CDS
ENSMUSE00001088626 WD40_repeat (38/38 aa) CDS
ENSMUSE00000165467 CDS
ENSMUSE00000165441 CDS
ENSMUSE00000737240 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112138 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKESLLLCLHPPSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000690582 UTR UTR
ENSMUSE00001010945 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001049859 CDS Deleted
ENSMUSE00001075173 CDS CDS + stop codon + UTR
ENSMUSE00001029088 (33/33 aa) CDS
ENSMUSE00001026976 CDS
ENSMUSE00001043780 CDS
ENSMUSE00001034096 CDS
ENSMUSE00001030055 CDS
ENSMUSE00001058804 WD40_repeat (2/33 aa) CDS
ENSMUSE00000996201 WD40_repeat (31/33 aa) CDS
ENSMUSE00001046485 CDS
ENSMUSE00001088626 WD40_repeat (38/38 aa) CDS
ENSMUSE00000165467 CDS
ENSMUSE00000165441 CDS
ENSMUSE00000690580 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000112139 protein_coding No protein product (NMD) view

Predicted translation: 

MSDKSDLKAELERKKQRLAQIREEKKRKEEERKKKESLLLCLHPPSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000690593 UTR UTR
ENSMUSE00001010945 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001049859 CDS Deleted
ENSMUSE00001075173 CDS CDS + stop codon + UTR
ENSMUSE00001029088 (33/33 aa) CDS
ENSMUSE00001026976 CDS
ENSMUSE00001043780 CDS
ENSMUSE00001034096 CDS
ENSMUSE00001030055 CDS
ENSMUSE00001058804 WD40_repeat (2/33 aa) CDS
ENSMUSE00000996201 WD40_repeat (31/33 aa) CDS
ENSMUSE00001046485 CDS
ENSMUSE00001088626 WD40_repeat (38/38 aa) CDS
ENSMUSE00000165467 CDS
ENSMUSE00000165441 CDS
ENSMUSE00000690584 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000137683 retained_intron Target region does not overlap transcript
ENSMUST00000149735 retained_intron No analysis available: incomplete transcript
ENSMUST00000138613 retained_intron Target region does not overlap transcript
ENSMUST00000141619 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0525_1_B10 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view yes view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_A12 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_C12 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_D10 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_E10 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_E12 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_F09 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_F10 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_F12 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_G11 PG00042_A_4_D07 Dync1i2tm1a(EUCOMM)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0397_6_B09 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_C04 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_C08 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_C11 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_E06 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_E09 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_E10 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_F04 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_F06 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_F10 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_F11 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_G04 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0397_6_H06 PGS00042_A_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_D12 PG00042_A_4_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0525_1_H12 PG00042_A_4_D07 Dync1i2tm1e(EUCOMM)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8A3.N1 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 39345 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00042_A_4_D07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 39345 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00042_A_2_D07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 39345 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00042_A_3_D07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 39345 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00042_A_D07 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
39345 Knockout First, Reporter-tagged insertion with conditional potential PCS00042_A_D07