IKMC Project Report - KOMP-CSD (ID: 31860)

Gm4847 MGI:3643320 ENSMUSG00000051081 OTTMUSG00000029828
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000046662 protein_coding No protein product (NMD) view

Predicted translation:

MGVKRIAVIGAGVSGLGAIKCCLEEGLEPTCFEKKSDIGGLWKYEESASSKAAISTPGSTNTPTTLWGREWQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000687734 UTR UTR
ENSMUSE00000593334 Flavin_mOase-like (41/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (40/217 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001034251 Flavin_mOase-like (63/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (63/217 aa) CDS Deleted
ENSMUSE00001011157 Flavin_mOase-like (55/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (55/217 aa) CDS Deleted
ENSMUSE00001089176 Flavin_mOase-like (48/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (48/217 aa) CDS CDS + stop codon + UTR
ENSMUSE00001010266 Flavin_mOase-like (67/528 aa) | Pyr_nucl-diS_OxRdtase_FAD/NAD (12/217 aa) CDS
ENSMUSE00001053461 Flavin_mOase-like (118/528 aa) CDS
ENSMUSE00000339570 Flavin_mOase-like (26/528 aa) CDS
ENSMUSE00000658721 Flavin_mOase-like (114/528 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available