IKMC Project Report - KOMP-CSD (ID: 32005)

Asb11 MGI:1916104 ENSMUSG00000031382 OTTMUSG00000019517
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 3 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 2 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000033755 protein_coding No protein product (NMD) view

Predicted translation:

MLQLAGEEGVRRPGPWKEISFGDYICHTFQGDCWADRSPLHEAAAQGRLLALKTLIAQGINVNLVTINRVSSLHEACLGG
HVACAKALLENGAHVTESAWRFC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000420325 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000237187 CDS CDS
ENSMUSE00000237180 Ankyrin_rpt (21/27 aa) CDS CDS
ENSMUSE00000237171 Ankyrin_rpt (6/27 aa) CDS Deleted
ENSMUSE00000208891 Ankyrin_rpt (21/26 aa) CDS CDS + stop codon + UTR
ENSMUSE00000237153 Ankyrin_rpt (6/26 aa) | Ankyrin_rpt (30/30 aa) CDS
ENSMUSE00000845118 SOCS_C (39/40 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000036858 protein_coding No protein product (NMD) view

Predicted translation:

MEDAPAFYGFKNIFLTMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGLSDCWADRSPLHEAAAQGRLLA
LKTLIAQGINVNLVTINRVSSLHEACLGGHVACAKALLENGAHVTESAWRFC*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000823232 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000237187 CDS CDS
ENSMUSE00000237180 Ankyrin_rpt (21/27 aa) CDS CDS
ENSMUSE00000237171 Ankyrin_rpt (6/27 aa) CDS Deleted
ENSMUSE00000208891 Ankyrin_rpt (21/26 aa) CDS CDS + stop codon + UTR
ENSMUSE00000237153 Ankyrin_rpt (6/26 aa) | Ankyrin_rpt (30/30 aa) CDS
ENSMUSE00000732527 SOCS_C (39/40 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000134085 retained_intron Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available