IKMC Project Report - EUCOMM (ID: 32063)

Ccnjl MGI:2685723 ENSMUSG00000044707 OTTMUSG00000005455
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Electroporation Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000050574 protein_coding No protein product (NMD) view

Predicted translation: 

MDEPWWEGRVASDVHCTLREKVSLKTGKTACLNWSR*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000679723 UTR UTR
ENSMUSE00000580195 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000337805 Cyclin_N (57/107 aa) CDS Deleted
ENSMUSE00000334246 Cyclin_C (50/114 aa) | Cyclin_N (51/107 aa) CDS CDS + stop codon + UTR
ENSMUSE00000382788 Cyclin_C (54/114 aa) CDS
ENSMUSE00000654226 Cyclin_C (12/114 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000152153 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 87038 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00086_A_A02 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 87038 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00086_Z_4_A03 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
87038 Knockout-First - Reporter Tagged Insertion PCS00086_A_A02