IKMC Project Report - EUCOMM (ID: 32088)

Zfp689 MGI:1918381 ENSMUSG00000048921 OTTMUSG00000022492
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - No QC Positives

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000053392 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAPPSAPLLLRAVGEAGPTRKRGRRPRALKFVDVAVYFSSEEWGCLQPAQRTLYRDVMRETYGLLGALGCAGPKPALISW
LERNTDDWEPAALDPQEYRRWVTFQR

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000435119 Krueppel-associated_box (39/40 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000359152 Krueppel-associated_box (2/40 aa) CDS CDS + stop codon + UTR
ENSMUSE00000373253 Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
ENSMUST00000106299 protein_coding Residual N-terminal, unknown C-terminal view

Predicted translation: 

MAPPSAPLLLRAVGEAGPTRKRGRRPRALKFVDVAVYFSSEEWGCLQPAQRTLYRDVMRETYGLLGALGCAGPKPALISW
LERNTDDWEPAALDPQEYRRWVTFQR

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000669377 Krueppel-associated_box (39/40 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000359152 Krueppel-associated_box (2/40 aa) CDS CDS + stop codon + UTR
ENSMUSE00000669376 Znf_C2H2 (23/23 aa) | Znf_C2H2 (19/23 aa) CDS Deleted
ENSMUSE00000669375 Znf_C2H2 (4/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) | Znf_C2H2 (23/23 aa) CDS + stop codon + UTR Deleted
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 47300 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00064_A_3_E07 L1L2_gt1 L3L4_pZero_DTA_kan view
order 47300 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00064_A_2_E07 L1L2_gt1 L3L4_pZero_DTA_kan view
order 47300 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00064_A_4_E07 L1L2_gt1 L3L4_pZero_DTA_kan view
order 47300 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00064_A_E07 L1L2_gt1 L3L4_pZero_DTA_kan view
order 47300 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00064_A_1_E07 L1L2_gt1 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
47300 Knockout First, Reporter-tagged insertion with conditional potential PCS00064_A_E07