IKMC Project Report - KOMP-CSD (ID: 32622)

Kcng4 MGI:1913983 ENSMUSG00000045246 OTTMUSG00000033798
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 2 wild type transcripts, of which 2 are protein-coding. Following removal of the floxed region, 2 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000061828 protein_coding Novel N-terminal, residual C-terminal product view

Predicted translation: 

MGSPCPAENQLGTHFLKQAGECTRKCYYIFVVESICVAWFSLEFCLRFVQAPNKCQFFRGPLNVIDILAISPYYVSLAVS
DESPEAGERPSSSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGLTVRRCAREFGLLMLFLAVAVTLFSPLVYVAE
NESGRVLEFTSIPASYWWAIISMTTVGYGDMVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLELKREQEQVQA
RLRRLQNTNSASERELLSDVDDLVPEGLTSPGRYM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000342429 UTR UTR + start codon + CDS
ENSMUSE00000386279 T1-type_BTB (100/100 aa) UTR + start codon + CDS Deleted
ENSMUSE00000378879 Ion_trans_dom (184/184 aa) | Ion_trans_2 (78/78 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000164382 protein_coding Novel N-terminal, residual C-terminal product view

Predicted translation: 

MGSPCPAENQLGTHFLKQAGECTRKCYYIFVVESICVAWFSLEFCLRFVQAPNKCQFFRGPLNVIDILAISPYYVSLAVS
DESPEAGERPSSSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGLTVRRCAREFGLLMLFLAVAVTLFSPLVYVAE
NESGRVLEFTSIPASYWWAIISMTTVGYGDMVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLELKREQEQVQA
RLRRLQNTNSASERELLSDVDDLVPEGLTSPGRYM*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000910681 UTR UTR + start codon + CDS
ENSMUSE00000386279 T1-type_BTB (100/100 aa) UTR + start codon + CDS Deleted
ENSMUSE00000879500 Ion_trans_dom (184/184 aa) | Ion_trans_2 (78/78 aa) CDS + stop codon + UTR CDS + stop codon + UTR
ENSMUSE00000911042 UTR UTR
Legend: in frame deleted frameshifted
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 111966 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00115_A_B06 L1L2_Bact_P L3L4_pZero_DTA_kan view
order 111966 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00115_Z_3_B06 L1L2_Bact_P L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
111966 Knockout First, Reporter-tagged insertion with conditional potential PCS00115_B_B06
111966 Knockout First, Reporter-tagged insertion with conditional potential PCS00115_A_B06