IKMC Project Report - KOMP-CSD (ID: 32777)

Dusp3 MGI:1919599 ENSMUSG00000003518 OTTMUSG00000002139
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 7 wild type transcripts, of which 7 are protein-coding. Following removal of the floxed region, 7 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000003612 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVPRVYVGNAPGACPLPRGLQPLPNASYRLPHDAAEDGRQVCSEYCEA
ES*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000750674 Dual-sp_phosphatase_cat-dom (5/139 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001023458 Dual-sp_phosphatase_cat-dom (77/139 aa) | Tyr_Pase_rcpt/non-rcpt (14/55 aa) CDS Deleted
ENSMUSE00000672300 Dual-sp_phosphatase_cat-dom (59/139 aa) | Tyr_Pase_rcpt/non-rcpt (42/55 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000107173 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MVMGCGTIRYLYSLCYDSVKRPAAAMSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVPRVYVGNAPGACPLPRGLQPL
PNASYRLPHDAAEDGRQVCSEYCEAES*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001062374 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001086828 Dual-sp_phosphatase_cat-dom (5/139 aa) CDS CDS
ENSMUSE00001023458 Dual-sp_phosphatase_cat-dom (77/139 aa) | Tyr_Pase_rcpt/non-rcpt (14/55 aa) CDS Deleted
ENSMUSE00000672300 Dual-sp_phosphatase_cat-dom (59/139 aa) | Tyr_Pase_rcpt/non-rcpt (42/55 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000107172 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVPRVYVGNAPGACPLPRGLQPLPNASYRLPHDAAEDGRQVCSEYCEA
ES*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001044081 UTR UTR
ENSMUSE00000672302 UTR UTR
ENSMUSE00001046980 Dual-sp_phosphatase_cat-dom (5/139 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001023458 Dual-sp_phosphatase_cat-dom (77/139 aa) | Tyr_Pase_rcpt/non-rcpt (14/55 aa) CDS Deleted
ENSMUSE00000672300 Dual-sp_phosphatase_cat-dom (59/139 aa) | Tyr_Pase_rcpt/non-rcpt (42/55 aa) CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000176261 protein_coding Residual N-terminal, novel C-terminal product view

Predicted translation: 

MSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVPRVYVGNAGFLGTQQLPCPGDSQRELPTTGLTEVLLTGVTVQQLWL
LVDGA

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00001046980 Dual-sp_phosphatase_cat-dom (5/87 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001023458 Dual-sp_phosphatase_cat-dom (77/87 aa) CDS Deleted
ENSMUSE00000960921 Dual-sp_phosphatase_cat-dom (7/87 aa) CDS + stop codon + UTR CDS
Legend: in frame deleted frameshifted
ENSMUST00000151678 protein_coding Novel (out of frame) product view

Predicted translation: 

MMRQKMDVKSALSTVRQNREIGPNDGFLAQLCQLNDRLAKEGKVKL*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000737922 UTR UTR
ENSMUSE00001067111 Dual-sp_phosphatase_cat-dom (42/100 aa) | Tyr_Pase_rcpt/non-rcpt (14/55 aa) UTR + start codon + CDS Deleted
ENSMUSE00000672300 Dual-sp_phosphatase_cat-dom (59/100 aa) | Tyr_Pase_rcpt/non-rcpt (42/55 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000143177 protein_coding Design floxes no exons in transcript ENSMUST00000143177
ENSMUST00000125794 protein_coding No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available