IKMC Project Report - KOMP-CSD (ID: 33245)

Tceanc2 MGI:1913776 ENSMUSG00000028619 OTTMUSG00000008470
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 9 wild type transcripts, of which 4 are protein-coding. Following removal of the floxed region, 4 transcripts are predicted to produce a truncated protein product of which 4 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000057043 protein_coding No protein product (NMD) view

Predicted translation: 

MDKFVIRTPRIQNSPKKKLGEKVYKQATIESLKVML*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000790451 UTR UTR
ENSMUSE00001059774 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000273854 TFIIS_N (20/50 aa) CDS Deleted
ENSMUSE00001001456 TFIIS_N (31/50 aa) | TFIIS_cen_dom (18/78 aa) CDS CDS + stop codon + UTR
ENSMUSE00000374572 TFIIS_cen_dom (60/78 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000030362 protein_coding No protein product (NMD) view

Predicted translation: 

MDKFVIRTPRIQNSPKKKLGEKVYKQATIESLKVML*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000671027 UTR UTR
ENSMUSE00001059774 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000273854 TFIIS_N (20/50 aa) CDS Deleted
ENSMUSE00001001456 TFIIS_N (31/50 aa) | TFIIS_cen_dom (18/78 aa) CDS CDS + stop codon + UTR
ENSMUSE00000482632 TFIIS_cen_dom (60/78 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000058585 protein_coding No protein product (NMD) view

Predicted translation: 

MDKFVIRTPRIQNSPKKKLGEKVYKQATIESLKVML*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000705711 UTR UTR
ENSMUSE00000900848 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000273854 TFIIS_N (20/50 aa) CDS Deleted
ENSMUSE00001001456 TFIIS_N (31/50 aa) | TFIIS_cen_dom (18/78 aa) CDS CDS + stop codon + UTR
ENSMUSE00000347006 TFIIS_cen_dom (60/78 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000141165 protein_coding No protein product (NMD) view

Predicted translation: 

MDKFVIRTPRIQNSPKKKLGEKVYKQATIESLKVML*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000759703 UTR UTR
ENSMUSE00001059774 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000273854 TFIIS_N (20/50 aa) CDS Deleted
ENSMUSE00001001456 TFIIS_N (31/50 aa) CDS CDS + stop codon + UTR
ENSMUSE00000818719 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000127720 nonsense_mediated_decay Design floxes no exons in transcript ENSMUST00000127720
ENSMUST00000147375 processed_transcript Target region does not overlap transcript
ENSMUST00000129220 processed_transcript No analysis available: incomplete transcript
ENSMUST00000132526 processed_transcript No analysis available: incomplete transcript
ENSMUST00000131474 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0131_3_F05 PRPGS00072_A_G01 Tceanc2tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0131_3_A07 PRPGS00072_A_G01 Tceanc2tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0131_3_H08 PRPGS00072_A_G01 Tceanc2tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0131_3_D08 PRPGS00072_A_G01 Tceanc2tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0131_3_E07 PRPGS00072_A_G01 Tceanc2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0131_3_C07 PRPGS00072_A_G01 Tceanc2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0131_3_G07 PRPGS00072_A_G01 Tceanc2tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotor Driven Cassette) JM8.N4 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 49422 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00072_Y_3_G01 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49422 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00072_Y_4_G01 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49422 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00072_Y_2_G01 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49422 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00072_Y_1_G01 L1L2_Bact_P L3L4_pD223_DTA_spec view
order 49422 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00072_A_G01 L1L2_Bact_P L3L4_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
49422 Knockout First, Reporter-tagged insertion with conditional potential PCS00072_A_G01