IKMC Project Report - (ID: 33348)

non-BioMart die(): Cannot write to '/nfs/team87/services/biomart/ikmc-mart/production/server/releases/20110531105342/logs/log4perl_log': at /software/team87/brave_new_world/lib/perl5/Log/Log4perl/Appender/File.pm line 245.
Pre-pipeline Designs Vectors ES Cells Mice

Mice no data available

Mutagenesis Predictions

This gene has 8 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 0 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000035181 protein_coding Residual C-terminal product view

Predicted translation: 

MLLLEALKVKQVVLESIPTFLKLPIAVTCYWLQSTEAKAKLHHLQALLLGMLREPLHAIVNSPGTEDPQRGGAKMLYEEL
CQVKAPMRPGPRVDLDTAHVFCQWQSCLQMGLYLNQLLSTPLPEPNLTWLYNGSLVHRLCQQLPASSSVESLLSLCPEAK
QLYEHLFNATKSYAPAELFLPKTKSKSKKKRQKKKVASLGTTADAKHWYDRSNRFGPLMPESLEEHVENSELE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000817454 UTR UTR
ENSMUSE00000384013 UTR + start codon + CDS Deleted
ENSMUSE00001026411 CDS UTR + start codon + CDS
ENSMUSE00001002544 CDS CDS
ENSMUSE00000812579 CDS + stop codon + UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000167674 protein_coding Target region does not overlap transcript
ENSMUST00000176940 protein_coding No analysis available: incomplete transcript
ENSMUST00000123807 nonsense_mediated_decay Novel (out of frame) product view

Predicted translation: 

MLLLEALKVKQVVLESIPTFLKLPIAVTCYWLQSTEAKAKLHHLQALLLGMLREPLHAIVNSPGTEDPQRGGAKMLYEEL
CQVKAPMRPGPRVDLDTAHVFCQWQSCLQMGLYLNQLLSTPLPEPNLTWLYNGSLVHRLCQQLPASSSVESLLSLCPEAK
QLYEHLFNATKSYAPAELFLPKTKSKSKKKRQKKKVASLGTTADAKHWYDRSNRFGPLMPESLEEHVENSELE*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000429062 UTR UTR
ENSMUSE00001004428 UTR + start codon + CDS Deleted
ENSMUSE00001001952 CDS + stop codon + UTR Deleted
ENSMUSE00000998203 UTR UTR + start codon + CDS
ENSMUSE00000996806 UTR CDS
ENSMUSE00000265849 UTR CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000177402 nonsense_mediated_decay No analysis available: incomplete transcript
ENSMUST00000176597 retained_intron No analysis available: incomplete transcript
ENSMUST00000137208 processed_transcript Target region does not overlap transcript
ENSMUST00000176350 processed_transcript No analysis available: incomplete transcript
show/hide more transcripts

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available