IKMC Project Report - KOMP-CSD (ID: 33358)

Pitrm1 MGI:1916867 ENSMUSG00000021193
Pre-pipeline Designs Vectors ES Cells Mice
Vector - Initial Attempt Unsuccessful

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type ''. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000021611 protein_coding No protein product (NMD) view

Predicted translation:

MWRFSGRRGLCAVQRLSCGRVHHRVWREKSDQACERALQYKVGEKIHGFTVNQVTPVPELFLTAVKLSHDNTGARYLHLA
REDKNNLFSVQFRTTPMDSTGVPHVLEHTVLCGSQKYPCRDPFFKMLNRSLSTFMNAMTDRQ*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000359255 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000384031 CDS CDS
ENSMUSE00000373600 CDS CDS
ENSMUSE00000340921 Pept_M16_N (44/82 aa) CDS CDS
ENSMUSE00000375130 Pept_M16_N (39/82 aa) CDS Deleted
ENSMUSE00000337202 Pept_M16_N (1/82 aa) CDS Deleted
ENSMUSE00000352730 Peptidase_M16_C (19/184 aa) CDS CDS + stop codon + UTR
ENSMUSE00000254151 Peptidase_M16_C (43/184 aa) CDS
ENSMUSE00000371441 Peptidase_M16_C (30/184 aa) CDS
ENSMUSE00000395751 Peptidase_M16_C (44/184 aa) CDS
ENSMUSE00000391099 Peptidase_M16_C (39/184 aa) CDS
ENSMUSE00000254023 Peptidase_M16_C (13/184 aa) CDS
ENSMUSE00000254012 CDS
ENSMUSE00000115506 Peptidase_M16C_assoc (37/249 aa) CDS
ENSMUSE00000115496 Peptidase_M16C_assoc (40/249 aa) CDS
ENSMUSE00000115488 Peptidase_M16C_assoc (45/249 aa) CDS
ENSMUSE00000115479 Peptidase_M16C_assoc (41/249 aa) CDS
ENSMUSE00000115492 Peptidase_M16C_assoc (26/249 aa) CDS
ENSMUSE00000115486 Peptidase_M16C_assoc (56/249 aa) CDS
ENSMUSE00000115503 Peptidase_M16C_assoc (8/249 aa) CDS
ENSMUSE00000115501 Peptidase_M16_C (28/165 aa) CDS
ENSMUSE00000115491 Peptidase_M16_C (24/165 aa) CDS
ENSMUSE00000115481 Peptidase_M16_C (38/165 aa) CDS
ENSMUSE00000115490 Peptidase_M16_C (43/165 aa) CDS
ENSMUSE00000115494 Peptidase_M16_C (34/165 aa) CDS
ENSMUSE00000115505 CDS
ENSMUSE00000334043 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors no data available

Intermediate Vectors no data available