IKMC Project Report - KOMP-CSD (ID: 33641)

Aldh1a7 MGI:1347050 ENSMUSG00000024747 OTTMUSG00000028314
Pre-pipeline Designs Vectors ES Cells Mice
ES Cells - Targeting Confirmed

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout-First - Reporter Tagged Insertion'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000025656 protein_coding No protein product (NMD) view

Predicted translation: 

MSSPAQPAVPAPLANLKIQHTKIFINNEWHDSVSSKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGSPWRTM
DASERGRLLNKLADLMERDRLLLAMETYSLIQGVNLLGCVAKSSLGMVH*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000829641 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001035435 Aldehyde_DH_dom (28/464 aa) CDS CDS
ENSMUSE00001058890 Aldehyde_DH_dom (47/464 aa) CDS CDS
ENSMUSE00001030402 Aldehyde_DH_dom (44/464 aa) CDS Deleted
ENSMUSE00000415018 Aldehyde_DH_dom (21/464 aa) | Acyl-CoA_reduct_LuxC (15/173 aa) CDS CDS
ENSMUSE00000984388 Aldehyde_DH_dom (43/464 aa) | Acyl-CoA_reduct_LuxC (43/173 aa) CDS CDS + stop codon + UTR
ENSMUSE00001027201 Aldehyde_DH_dom (38/464 aa) | Acyl-CoA_reduct_LuxC (38/173 aa) CDS
ENSMUSE00000998552 Aldehyde_DH_dom (35/464 aa) | Acyl-CoA_reduct_LuxC (35/173 aa) CDS
ENSMUSE00001044980 Aldehyde_DH_dom (62/464 aa) | Acyl-CoA_reduct_LuxC (43/173 aa) CDS
ENSMUSE00001046720 Aldehyde_DH_dom (55/464 aa) CDS
ENSMUSE00001041906 Aldehyde_DH_dom (53/464 aa) CDS
ENSMUSE00000990233 Aldehyde_DH_dom (26/464 aa) CDS
ENSMUSE00000144708 Aldehyde_DH_dom (16/464 aa) CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones With Conditional Potential

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0106_4_B04 PRPGS00059_A_H03 Aldh1a7tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number fail Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0106_4_B03 PRPGS00059_A_H03 Aldh1a7tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0106_4_E03 PRPGS00059_A_H03 Aldh1a7tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot pass Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation pass
3' LR-PCR -
order EPD0106_4_E03 PRPGS00059_A_H03 Aldh1a7tm1a(KOMP)Wtsi Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not attempted LoxP Screen pass 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA pass LOXP pass LACZ pass
Chromosome 1 pass Chromosome 8a pass Chromosome 8b -
Chromosome 11a - Chromosome 11b pass Chromosome Y pass
User/Mouse Clinic
Southern Blot pass Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation pass
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 46236 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00059_Z_3_H03 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46236 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00059_Z_1_H02 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46236 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00059_Z_4_H03 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46236 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00059_Z_1_H03 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46236 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PG00059_Z_2_H03 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 46236 Knockout-First - Reporter Tagged Insertion (Promotor Driven Cassette) PRPGS00059_A_H03 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
46236 Knockout-First - Reporter Tagged Insertion PCS00059_A_H03