IKMC Project Report - EUCOMM (ID: 33822)

Aaed1 MGI:1913379 ENSMUSG00000021482
Pre-pipeline Designs Vectors ES Cells Mice
Vector Complete

Mice no data available

Mutagenesis Predictions

This gene has 1 wild type transcripts, of which 1 are protein-coding. Following removal of the floxed region, 1 transcript is predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000021938 protein_coding No protein product (NMD) view

Predicted translation: 

MAAPVTRQVSGCAGRVPSPAGSVTERGQPLAAAVAELPVLDASGRRVTFGALFRERRAVVVFVRHFLCYVCKEYVEDLAK
IPKSVLRDRAPT*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000118201 Redoxin (30/99 aa) | AhpC/TSA (27/98 aa) UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00000118203 Redoxin (23/99 aa) | AhpC/TSA (23/98 aa) CDS CDS
ENSMUSE00000118209 Redoxin (18/99 aa) | AhpC/TSA (18/98 aa) CDS Deleted
ENSMUSE00000118200 Redoxin (28/99 aa) | AhpC/TSA (30/98 aa) CDS Deleted
ENSMUSE00000118207 CDS CDS + stop codon + UTR
ENSMUSE00001050495 CDS + stop codon + UTR
Legend: in frame deleted frameshifted

ES Cell Clones no data available

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 84817 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PRPGS00088_A_A10 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 84817 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00088_Y_2_A10 L1L2_Bact_P L4L3_pD223_DTA_spec view
order 84817 Knockout First, Reporter-tagged insertion with conditional potential (Promotor Driven Cassette) PG00088_Y_4_A10 L1L2_Bact_P L4L3_pD223_DTA_spec view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
84817 Knockout First, Reporter-tagged insertion with conditional potential PCS00088_A_A10