IKMC Project Report - KOMP-CSD (ID: 34134)

Akap9 MGI:2178217 ENSMUSG00000040407 OTTMUSG00000016263
Pre-pipeline Designs Vectors ES Cells Mice
Mice - Phenotype Data Available

Mice

Microinjection Status Allele Allele Type ES Cell Clone Genetic Background QC Data MI/Distribution Centre
contact distributor Genotype confirmed Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) EPD0033_5_D02 C57BL/6Dnk;C57BL/6Brd-Tyrc-Brd;C57BL/6N view
( about ) 		WTSI/UCD
Southern Blot na TV Backbone Assay pass 5' LR-PCR pass
Loss of WT Allele (LOA) qPCR na Homozygous Loss of WT Allele (LOA) SR-PCR pass Neo Count (qPCR) pass
LacZ SR-PCR pass 5' Cassette Integrity Neo SR-PCR na
Mutant Specific SR-PCR pass LoxP Confirmation pass 3' LR-PCR
Genotyping Comment -

Mutagenesis Predictions

This gene has 10 wild type transcripts, of which 3 are protein-coding. Following removal of the floxed region, 3 transcripts are predicted to produce a truncated protein product of which 1 may be subject to non-sense mediated decay (NMD). The original allele for this mutation is of type 'Knockout First, Reporter-tagged insertion with conditional potential'. The table below shows the predicted structure of the gene transcripts after application of Flp and Cre (forming a 'Knockout-First, Post-Flp and Cre - Deletion, No Reporter' allele - more information on IKMC alleles can be found here). Click the 'view' button for each transcript to see the full prediction for that transcript.

Ensembl transcript id Ensembl Biotype Floxed transcript description Details
ENSMUST00000044492 protein_coding No protein product (NMD) view

Predicted translation: 

MEDEERQRKLAAGKAKLARFRQRKAQYDGDIPKKQKKKRTSSSKHDSSLHTDQQSGELCSESSQRVDLAGNPDCSGPERK
HGQVFSAEPESEISTTADECSSEEEEFSLDDSSSEQGAQSSQTCLQMVEKELAEKQHDIEELTQELEEMRASFGTEGLKQ
LQEFEAAIKQRDGIITQLTANLQQARREKDDTMVEFLELTEQSQKLQIQFQHLQANETLQNSTLSRTATDLLQAKRQIFT
QQQQLQDYQKKEEDLQAQISFLQEKLRAFEMEKDRKIENLNAKEIQEKQALIDELNTRVVEEEKKTVELKNKVTTADELL
GGLHEQLTQRNQEIQSLKLELGNSQQNERKCSEEIKELMRTVEELQKRNLKDSWLETSAVRRVEQETQRKLSHLQAELDE
MYGKQIVQMKQELINQHMSQIEELKSQHKREMENTLKSDTNAAISKEQVNLMNAAINELNVRLQETHAQKEELKGELGVV
LGEKSALQSQSNDLLEEVRFLREQVQKARQTIAEQENRLSEARKSLSTVEDLKAEIVAASESRKELELKHEAEITNYKIK
LEMLEKEKNAVLDRMAESQEAELERLRTQLLFSHEEELSKLKEDLEVEHRINIEKLKDNLGIHYKQQIDGLQNEMNRKME
SMQCETDNLITQQNQLILENSKLRDLQECLVNSKSEEMNLQINELQKEIEILKQEEKEKGTLEQEVQELQLKTEQLEKQL
KEKEDDLQEKCAQLDAENNILKEEKRVLEDKLKMYSPSEQEERSIAVDPSTSKSADSRWQKEVAMLRKETEDLQQQCLYL
NEEIEKQRNTFAFAEKNFEVNYQELQREYTCLLKIRDDLEATQTKQALEYESKLRALEEELLSKRGNPAAPKGKSSGIFP
SETLEIGEVVEKDTTELMEKLEVTKREKLELSEKVSGLSEQLKQTHCTINSLSAEVRALKQEKEQLLLRCGELELLANPS
GTENAAVCPVQMSSYQAGLVMGKVGDSGGSISKISKDLAEESKPMIEDKIPFKESGREQLLLPTRAQKPSHATVEPCESE
KLQQELHALKAEQVMSLYRCSLNDFNRQCLRNAFTFQRP*

Ensembl Exon ID Pfam Domains WildType Floxed
ENSMUSE00000993594 UTR + start codon + CDS UTR + start codon + CDS
ENSMUSE00001080854 CDS CDS
ENSMUSE00000981377 CDS CDS
ENSMUSE00000656233 CDS CDS
ENSMUSE00001095007 CDS CDS
ENSMUSE00000656229 CDS CDS
ENSMUSE00000887042 CDS CDS
ENSMUSE00000505652 CDS Deleted
ENSMUSE00000503624 CDS CDS
ENSMUSE00000381275 CDS CDS + stop codon + UTR
ENSMUSE00001052423 CDS
ENSMUSE00000981065 CDS
ENSMUSE00000970251 CDS
ENSMUSE00000333130 CDS
ENSMUSE00000382496 CDS
ENSMUSE00000481796 CDS
ENSMUSE00000506559 CDS
ENSMUSE00000184844 CDS
ENSMUSE00000299683 CDS
ENSMUSE00000299676 CDS
ENSMUSE00000184840 CDS
ENSMUSE00000299661 CDS
ENSMUSE00000517054 CDS
ENSMUSE00000416357 CDS
ENSMUSE00000416333 CDS
ENSMUSE00000416325 CDS
ENSMUSE00000416319 CDS
ENSMUSE00000416314 CDS
ENSMUSE00000416308 CDS
ENSMUSE00000416301 CDS
ENSMUSE00000416296 CDS
ENSMUSE00000416292 CDS
ENSMUSE00000416289 CDS
ENSMUSE00000416283 CDS
ENSMUSE00000416276 CDS
ENSMUSE00000416270 CDS
ENSMUSE00000416267 CDS
ENSMUSE00000416262 CDS
ENSMUSE00000339553 CDS
ENSMUSE00000299843 CDS
ENSMUSE00000299837 CDS
ENSMUSE00001032436 CDS
ENSMUSE00001053868 CDS
ENSMUSE00000299806 PACT_domain (73/83 aa) CDS
ENSMUSE00000407283 PACT_domain (11/83 aa) CDS
ENSMUSE00000332095 CDS
ENSMUSE00000364998 CDS
ENSMUSE00000403453 CDS + stop codon + UTR
Legend: in frame deleted frameshifted
ENSMUST00000143365 protein_coding Target region does not overlap transcript
ENSMUST00000176863 protein_coding Target region does not overlap transcript
ENSMUST00000147629 nonsense_mediated_decay Target region does not overlap transcript
ENSMUST00000132058 retained_intron Target region does not overlap transcript
ENSMUST00000123119 retained_intron Target region does not overlap transcript
ENSMUST00000133952 retained_intron Target region does not overlap transcript
ENSMUST00000141817 retained_intron Target region does not overlap transcript
ENSMUST00000177448 retained_intron Target region does not overlap transcript
ENSMUST00000140977 processed_transcript Target region does not overlap transcript
show/hide more transcripts

ES Cell Clones With Knockout First Mutation (Reporter Tagged Insertion With Conditional Potential)

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0033_5_D02 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view yes view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR pass Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_B01 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity pass
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_E03 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number pass Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_C02 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_D01 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR pass
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_G03 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_H02 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR pass 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_A02 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_A03 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_B02 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_B03 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_C01 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_C03 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_D03 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_E02 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_F01 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_F02 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_G02 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen not confirmed LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_H01 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_H03 PGS00023_E_A08 Akap9tm1a(KOMP)Wtsi Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen pass 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

ES Cell Clones Without Conditional Potential

Note: Mutations of type "Without Conditional Potential" are correctly targeted clones that have lost the 3' LoxP site. These mutations cannot be converted into conditional alleles.

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: Southern Blot Tool - LRPCR Genotyping Primers
ES Cell Clone Targeting Vector Allele Allele Type Parental ES Cell Line Genbank File Mouse QC Data
order EPD0033_5_A01 PGS00023_E_A08 Akap9tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_E01 PGS00023_E_A08 Akap9tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_F03 PGS00023_E_A08 Akap9tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen pass
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
order EPD0033_5_G01 PGS00023_E_A08 Akap9tm1e(KOMP)Wtsi Targeted Non-Conditional (Promotorless Cassette) JM8.F6 view no view    ( about )
Production Centre
5' Screen pass LoxP Screen not confirmed 3' Screen not confirmed
Loss of WT Allele (LOA) - Vector Integrity -
Distribution Centre
Karyotype - Copy Number - Cells Thawed Correctly -
5' LR-PCR - 5' SR-PCR - 3' SR-PCR -
LOA - LOXP - LACZ -
Chromosome 1 - Chromosome 8a - Chromosome 8b -
Chromosome 11a - Chromosome 11b - Chromosome Y -
User/Mouse Clinic
Southern Blot - Map Test - Karyotype -
TV Backbone Assay - 5' LR-PCR - Loss of WT Allele (LOA) -
Neo Count (qPCR) - LacZ SR-PCR - 5' Cassette Integrity -
Neo SR-PCR - Mutant Specific SR-PCR - LoxP Confirmation -
3' LR-PCR -
show/hide more ES cells

Targeting Vectors

Genome Browsers: Ensembl (mouse) - UCSC (mouse)
Tools: LRPCR Genotyping Primers
Design ID Vector Type Targeting Vector Cassette Backbone Genbank File
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_E_3_A07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_4_A07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_1_A08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_3_H08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_E_3_A08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_C_1_A08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_E_2_A07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_2_A08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_3_A08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_C_2_A07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_C_1_A07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_C_2_H08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00023_A_A08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_E_1_A07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_1_A07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_4_A08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_1_H08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_D_2_A07 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PG00023_E_1_A08 L1L2_gt0 L3L4_pZero_DTA_kan view
order 37213 Knockout First, Reporter-tagged insertion with conditional potential (Promotorless Cassette) PGS00023_E_A08 L1L2_gt0 L3L4_pZero_DTA_kan view
show/hide more targeting vectors

Intermediate Vectors

Design ID Vector Type Intermediate Vector
37213 Knockout First, Reporter-tagged insertion with conditional potential PCS00023_E_A08